Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009302592.1 | Gene: | cep78 / 564741 | ZFINID: | ZDB-GENE-070905-1 | Length: | 672 | Species: | Danio rerio |
Alignment Length: | 320 | Identity: | 72/320 - (22%) |
---|---|---|---|
Similarity: | 115/320 - (35%) | Gaps: | 107/320 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 106 PVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSL-EGTPLTDEDVRILREFLLVSKTLRRLNVSS 169
Fly 170 CSLTQFNFALIADGVY------KSPGVR-----------------RLSANRLLGM-SLSLDTEKI 210
Fly 211 SSVLSSLLMQNTLWALSLEHCELTAQDMIPI------------------------AEHLA----- 246
Fly 247 ---RTNS-------KFRRL---------RIACNK---IGPDGAFFLLRGMSMGGNLELLDLSYCS 289
Fly 290 IGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSR 349 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 7/27 (26%) |
LRR_RI | 137..374 | CDD:238064 | 64/289 (22%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 8/32 (25%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 3/17 (18%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 14/66 (21%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 10/38 (26%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 4/14 (29%) | ||
cep78 | XP_009302592.1 | LRR_RI | 12..293 | CDD:238064 | 64/285 (22%) |
leucine-rich repeat | 101..125 | CDD:275381 | 2/23 (9%) | ||
leucine-rich repeat | 126..145 | CDD:275381 | 3/18 (17%) | ||
leucine-rich repeat | 149..176 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 177..203 | CDD:275381 | 4/25 (16%) | ||
leucine-rich repeat | 204..227 | CDD:275381 | 4/22 (18%) | ||
leucine-rich repeat | 228..250 | CDD:275381 | 7/21 (33%) | ||
leucine-rich repeat | 251..284 | CDD:275381 | 7/32 (22%) | ||
leucine-rich repeat | 285..307 | CDD:275381 | 8/29 (28%) | ||
MreC | <425..>542 | CDD:302802 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |