| Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038957056.1 | Gene: | Nlrp14 / 499234 | RGDID: | 1598218 | Length: | 1007 | Species: | Rattus norvegicus |
| Alignment Length: | 246 | Identity: | 62/246 - (25%) |
|---|---|---|---|
| Similarity: | 108/246 - (43%) | Gaps: | 42/246 - (17%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 124 MLRLNAAKMNVSQ----------------LSLEGTPLTDEDVRILREFL-LVSKTLRRLNVSSCS 171
Fly 172 LTQFNFALIADGVYKSPGVRRLSANRLLGMSLS---LDTEKISSVLSSLLM--QNTLWALSLEHC 231
Fly 232 ELTAQDMIPI-AEHLA---RTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIG 291
Fly 292 THGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKK-QCKLEKLTL 341 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 8/43 (19%) |
| LRR_RI | 137..374 | CDD:238064 | 57/217 (26%) | ||
| leucine-rich repeat | 162..189 | CDD:275381 | 8/26 (31%) | ||
| leucine-rich repeat | 202..220 | CDD:275380 | 7/22 (32%) | ||
| leucine-rich repeat | 223..251 | CDD:275380 | 11/31 (35%) | ||
| leucine-rich repeat | 252..279 | CDD:275380 | 5/27 (19%) | ||
| leucine-rich repeat | 280..307 | CDD:275380 | 6/26 (23%) | ||
| leucine-rich repeat | 308..335 | CDD:275380 | 6/27 (22%) | ||
| leucine-rich repeat | 336..357 | CDD:275380 | 2/6 (33%) | ||
| Nlrp14 | XP_038957056.1 | NACHT | 95..262 | CDD:399032 | |
| NOD2_WH | 339..394 | CDD:407651 | |||
| NLRC4_HD2 | 396..513 | CDD:407648 | |||
| LRR_RI | <580..740 | CDD:423007 | 15/62 (24%) | ||
| leucine-rich repeat | 646..674 | CDD:275381 | |||
| LRR_RI | 675..963 | CDD:423007 | 62/246 (25%) | ||
| leucine-rich repeat | 675..702 | CDD:275381 | 5/24 (21%) | ||
| leucine-rich repeat | 703..731 | CDD:275381 | 7/27 (26%) | ||
| leucine-rich repeat | 732..759 | CDD:275381 | 8/34 (24%) | ||
| leucine-rich repeat | 760..787 | CDD:275381 | 8/27 (30%) | ||
| leucine-rich repeat | 789..816 | CDD:275381 | 11/31 (35%) | ||
| leucine-rich repeat | 817..845 | CDD:275381 | 5/27 (19%) | ||
| leucine-rich repeat | 874..898 | CDD:275380 | 6/23 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000189 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.000 | |||||