DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Nlrp4

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001165635.2 Gene:Nlrp4 / 499069 RGDID:1563529 Length:982 Species:Rattus norvegicus


Alignment Length:390 Identity:86/390 - (22%)
Similarity:158/390 - (40%) Gaps:62/390 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQRE----YDKRPYRQFQFKRLTFEERIGRRYH 62
            |..|....::.:...|...|.|  :|..||.||...    ...:.....|.|.....|..     
  Rat   594 CSTLKKLSFSTQNILSEEQEHS--YTEKLLICWHHMCSVLISSKDIHVLQVKDTNLNETA----- 651

  Fly    63 CIRDLRIIVNYLLRRPQLSVQISSLVVSN----WDAGLLKDFVRSLLPVWYIELRLMRFPREFFV 123
                ..::.|: |:.|..::::  |||:|    .|..|..:.::: ..:.::.|.|.........
  Rat   652 ----FWVLYNH-LKYPSCTLKV--LVVNNVTFLCDNHLFFELIQN-QRLQHLNLSLTFLSHSDVK 708

  Fly   124 ML--RLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSS----------------- 169
            :|  .||.|:.|:.:|.:....|:.:|.::....|:.||.|:.||:||                 
  Rat   709 LLCDVLNQAECNIEKLMIAACNLSPDDCKVFASVLISSKMLKHLNLSSNNLDKGISSLCKALCHP 773

  Fly   170 -----------CSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNT- 222
                       |||::..:..:::.|.::..:..|..:     |..|..|.:..:..:|.:.:: 
  Rat   774 DCILKHLVLANCSLSEQCWDYLSEVVRRNKTLSHLDIS-----SNDLKDEGLKVLCGALTLPDSG 833

  Fly   223 LWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLS 286
            |.:||:.||.:|......:||.| |.|...|.|:::.|||...|...|...:.... :||.:.|.
  Rat   834 LISLSVRHCLITTSGCQDLAEVL-RHNQNLRSLQVSNNKIEDAGVKLLCDAIKQPNCHLENIGLE 897

  Fly   287 YCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQ-CKLEKLTLYGNHFDSRT 350
            .|.:.....:.:|.....|:.|..::|..|.:..:.:.::..|:|:| |.|..|.|....||..|
  Rat   898 ACELTGACCKDLASAFVHCKTLWGINLLENALDHSGLVVLFEALKQQKCTLHVLGLRITDFDKET 962

  Fly   351  350
              Rat   963  962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 57/245 (23%)
leucine-rich repeat 162..189 CDD:275381 9/54 (17%)
leucine-rich repeat 202..220 CDD:275380 4/17 (24%)
leucine-rich repeat 223..251 CDD:275380 11/27 (41%)
leucine-rich repeat 252..279 CDD:275380 7/27 (26%)
leucine-rich repeat 280..307 CDD:275380 6/26 (23%)
leucine-rich repeat 308..335 CDD:275380 6/27 (22%)
leucine-rich repeat 336..357 CDD:275380 6/15 (40%)
Nlrp4NP_001165635.2 Pyrin_NALPs 10..92 CDD:260032
NACHT 148..317 CDD:399032
NOD2_WH 393..449 CDD:407651
NLRC4_HD2 451..564 CDD:407648
leucine-rich repeat 666..691 CDD:275381 6/27 (22%)
LRR_RI 689..953 CDD:423007 60/270 (22%)
leucine-rich repeat 692..720 CDD:275381 6/27 (22%)
leucine-rich repeat 721..748 CDD:275381 5/26 (19%)
leucine-rich repeat 749..772 CDD:275381 5/22 (23%)
leucine-rich repeat 777..804 CDD:275381 4/26 (15%)
leucine-rich repeat 805..826 CDD:275381 4/25 (16%)
leucine-rich repeat 827..861 CDD:275381 12/34 (35%)
leucine-rich repeat 891..918 CDD:275380 6/26 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.