DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and TONSL

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_038460.4 Gene:TONSL / 4796 HGNCID:7801 Length:1378 Species:Homo sapiens


Alignment Length:370 Identity:79/370 - (21%)
Similarity:127/370 - (34%) Gaps:132/370 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   104 LLPV----------WYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLV 158
            |:||          |..|....|:.:...::.||...|        ||..|..:|        |:
Human   945 LIPVPHSSDTHSVAWLAEQAAQRYYQTCGLLPRLTLRK--------EGALLAPQD--------LI 993

  Fly   159 SKTLRRLNVSSCSLTQFNFALIADGVYKS-----PGVRR--LSANRLLGM-------SLSLDTEK 209
            ...|:..:.....:|.::...:.|...::     .|..:  |.|..|.|:       ||:||..:
Human   994 PDVLQSNDEVLAEVTSWDLPPLTDRYRRACQSLGQGEHQQVLQAVELQGLGLSFSACSLALDQAQ 1058

  Fly   210 ISSVLSSLLMQNTLWALSL------EHCELTAQDMIPIAEHLAR--TNSKFRRLRIACNKIGPDG 266
            ::.:|.:|.:...|..|.|      :.|         :||.:|.  |......|.::.|.:||:|
Human  1059 LTPLLRALKLHTALRELRLAGNRLGDKC---------VAELVAALGTMPSLALLDLSSNHLGPEG 1114

  Fly   267 AFFLLRGMSMG-------GNLELLDLSYCSIGTHGGEWVAKYLASC------------------- 305
                ||.::||       .:||.||||...:|...|:.:|..|.:|                   
Human  1115 ----LRQLAMGLPGQATLQSLEELDLSMNPLGDGCGQSLASLLHACPLLSTLRLQACGFGPSFFL 1175

  Fly   306 -------------RRLQVLHLNYNDMGPTAVNLILLAM--------------------------- 330
                         ..|:.|.|:||.:|..|:...|.::                           
Human  1176 SHQTALGSAFQDAEHLKTLSLSYNALGAPALARTLQSLPAGTLLHLELSSVAAGKGDSDLMEPVF 1240

  Fly   331 ----KKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDIS 371
                |:.|.|..|||..||...:....:.|.|.....|.| ||:|
Human  1241 RYLAKEGCALAHLTLSANHLGDKAVRDLCRCLSLCPSLIS-LDLS 1284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 70/327 (21%)
leucine-rich repeat 162..189 CDD:275381 3/31 (10%)
leucine-rich repeat 202..220 CDD:275380 6/17 (35%)
leucine-rich repeat 223..251 CDD:275380 8/35 (23%)
leucine-rich repeat 252..279 CDD:275380 9/33 (27%)
leucine-rich repeat 280..307 CDD:275380 11/58 (19%)
leucine-rich repeat 308..335 CDD:275380 9/57 (16%)
leucine-rich repeat 336..357 CDD:275380 6/20 (30%)
TONSLNP_038460.4 TPR_12 23..99 CDD:290160
TPR 1 27..60
TPR repeat 27..55 CDD:276809
TPR repeat 66..96 CDD:276809
TPR 2 67..100
TPR 3 107..147
TPR repeat 107..131 CDD:276809
TPR 4 162..195
TPR repeat 163..190 CDD:276809
TPR 187..>418 CDD:223533
TPR repeat 195..231 CDD:276809
TPR 5 202..235
TPR 6 242..275
TPR repeat 242..270 CDD:276809
TPR repeat 276..300 CDD:276809
TPR 7 311..344
TPR repeat 316..339 CDD:276809
TPR repeat 351..381 CDD:276809
TPR 8 352..385
TPR repeat 390..419 CDD:276809
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 475..524
ANK 523..635 CDD:238125
ANK repeat 528..559 CDD:293786
ANK 1 528..557
Ank_2 533..627 CDD:289560
ANK repeat 561..592 CDD:293786
ANK 2 561..590
ANK repeat 594..627 CDD:293786
ANK 3 597..626
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 667..789
PRR18 707..>919 CDD:292299
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 842..933
LRR_RI 1045..1306 CDD:238064 57/254 (22%)
LRR 1 1069..1093 6/32 (19%)
LRR_8 1072..1141 CDD:290566 23/81 (28%)
leucine-rich repeat 1072..1099 CDD:275380 8/35 (23%)
LRR 2 1097..1122 8/28 (29%)
leucine-rich repeat 1100..1130 CDD:275380 9/33 (27%)
LRR 3 1128..1151 8/22 (36%)
leucine-rich repeat 1131..1158 CDD:275380 11/26 (42%)
leucine-rich repeat 1159..1190 CDD:275380 0/30 (0%)
LRR 4 1188..1212 8/23 (35%)
leucine-rich repeat 1191..1215 CDD:275380 8/23 (35%)
leucine-rich repeat 1216..1249 CDD:275380 1/32 (3%)
LRR 5 1247..1270 7/22 (32%)
leucine-rich repeat 1250..1277 CDD:275380 8/26 (31%)
LRR 6 1275..1300 5/11 (45%)
leucine-rich repeat 1278..1300 CDD:275380 5/8 (63%)
leucine-rich repeat 1308..1333 CDD:275380
LRR 7 1331..1354
leucine-rich repeat 1334..1355 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.