DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Nlrp4e

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001004194.2 Gene:Nlrp4e / 446099 MGIID:3056600 Length:978 Species:Mus musculus


Alignment Length:397 Identity:95/397 - (23%)
Similarity:154/397 - (38%) Gaps:76/397 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CDVLLPCEYNPKECPSPAAEKSRLFTILLLYCWQRE----YDKRPYRQFQFKRLTFEERIGRRYH 62
            |..|.....:.:...|...|.|  :|..||.||...    ...:.....|.|...|.||      
Mouse   594 CSTLKKLSLSTQNILSEGQEHS--YTEKLLICWHHVCSVLTSSKDIHVLQVKDTNFNER------ 650

  Fly    63 CIRDLRIIVNYL-LRRPQLSVQISSLVVSN----WDAGLLKDFVRSLLPVWYIELRLMRFPREFF 122
                 ..:|.|. |:.|...:::  |.|:|    .|..||.:.:::.      .|:|:.....|.
Mouse   651 -----AFLVLYSHLKYPSCILKV--LEVNNVTLLCDNRLLFELIQNQ------RLQLLNLSLTFL 702

  Fly   123 ----VMLR---LNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSS----------- 169
                |.|.   ||.|:.|:.:|.:....|:.:|.::....|:.||.|:.||:||           
Mouse   703 SHNDVKLLCDVLNQAECNIEKLMVADCNLSPDDCKVFVSVLISSKMLKHLNLSSNNLDKGISSLS 767

  Fly   170 -----------------CSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLS-LDTEKISSVLSS 216
                             |||::..:.      |.|..:||......|.:|.: |..|.:..:..:
Mouse   768 KALCHPDCVLKNLVLAKCSLSEECWH------YLSEVLRRNKTLTHLDISFNDLKDEGLKVLCGA 826

  Fly   217 L-LMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-N 279
            | |..:.|.:||:.:|.:|......:||.| |.|...|.|:|:.|||...|...|...:.... :
Mouse   827 LTLPDSVLISLSVRYCLITTSGCQDLAEVL-RNNQNLRNLQISNNKIEDAGVKLLCDAIKHPNCH 890

  Fly   280 LELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMK-KQCKLEKLTLYG 343
            ||.:.|..|::.....|.:|.....|:.|..::|..|.:..:.:..:..||| :||.:....|..
Mouse   891 LENIGLEACALTGACCEDLASSFTHCKTLLGINLQENALDHSGLVALFEAMKQQQCTVNLRGLRI 955

  Fly   344 NHFDSRT 350
            ..||..|
Mouse   956 TDFDKET 962

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 61/246 (25%)
leucine-rich repeat 162..189 CDD:275381 10/54 (19%)
leucine-rich repeat 202..220 CDD:275380 5/19 (26%)
leucine-rich repeat 223..251 CDD:275380 10/27 (37%)
leucine-rich repeat 252..279 CDD:275380 8/27 (30%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 7/27 (26%)
leucine-rich repeat 336..357 CDD:275380 4/15 (27%)
Nlrp4eNP_001004194.2 Pyrin_NALPs 10..92 CDD:260032
NACHT 148..316 CDD:283404
LRR 1 594..617 5/24 (21%)
leucine-rich repeat 666..691 CDD:275381 6/32 (19%)
LRR_RI 681..960 CDD:238064 70/291 (24%)
leucine-rich repeat 692..720 CDD:275381 8/27 (30%)
LRR 2 694..717 6/22 (27%)
leucine-rich repeat 721..748 CDD:275381 5/26 (19%)
LRR 742..>929 CDD:227223 49/193 (25%)
LRR 3 746..773 7/26 (27%)
leucine-rich repeat 749..772 CDD:275381 5/22 (23%)
leucine-rich repeat 777..804 CDD:275381 7/32 (22%)
LRR 4 802..825 4/22 (18%)
leucine-rich repeat 805..826 CDD:275381 4/20 (20%)
leucine-rich repeat 827..861 CDD:275381 12/34 (35%)
LRR 5 859..882 9/22 (41%)
LRR 6 916..940 4/23 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.