DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and CIITA

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_006720943.2 Gene:CIITA / 4261 HGNCID:7067 Length:1229 Species:Homo sapiens


Alignment Length:445 Identity:91/445 - (20%)
Similarity:142/445 - (31%) Gaps:149/445 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PSPAAEKSRLFTILLLYC-----WQR-----------EY------DKRPYRQFQ------FKRLT 52
            |..|||....|...||.|     |..           :|      .||||..:.      ...|.
Human   797 PPRAAESELAFPSFLLQCFLGALWLALSGEIKDKELPQYLALTPRKKRPYDNWLEGVPRFLAGLI 861

  Fly    53 FEERIGRRYHCI-------------RDLRIIVNYL-------LRRPQLSVQISSLVVSNWDAGLL 97
            |:...    .|:             |..:::..||       ||..|| :::........:||:.
Human   862 FQPPA----RCLGALLGPSAAASVDRKQKVLARYLKRLQPGTLRARQL-LELLHCAHEAEEAGIW 921

  Fly    98 KDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTL 162
            :..|:.|                             ..:||..||.||..|..:|.:.|      
Human   922 QHVVQEL-----------------------------PGRLSFLGTRLTPPDAHVLGKAL------ 951

  Fly   163 RRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALS 227
                  ..:...|:..|      :|.|:.......|:|:|.   ..:..:.||..:   .||...
Human   952 ------EAAGQDFSLDL------RSTGICPSGLGSLVGLSC---VTRFRAALSDTV---ALWESL 998

  Fly   228 LEHCEL----TAQDMIPIAEHLA----------------RTNSK-------------FRRLRIAC 259
            .:|.|.    .|::...|....|                ||.|.             .::|..|.
Human   999 QQHGETKLLQAAEEKFTIEPFKAKSLKDVEDLGKLVQTQRTRSSSEDTAGELPAVRDLKKLEFAL 1063

  Fly   260 NKI-GPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLAS---CRRLQVLHLNYN---D 317
            ..: ||.....|:|.::...:|:.|||...|....|.|.|::..|:   .:.|:.|:|:.|   |
Human  1064 GPVSGPQAFPKLVRILTAFSSLQHLDLDALSENKIGDEGVSQLSATFPQLKSLETLNLSQNNITD 1128

  Fly   318 MGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDISY 372
            :|  |..|..........|.:|:||.|......|..:.|:|...|.|. .:|:.|
Human  1129 LG--AYKLAEALPSLAASLLRLSLYNNCICDVGAESLARVLPDMVSLR-VMDVQY 1180

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 9/26 (35%)
LRR_RI 137..374 CDD:238064 63/276 (23%)
leucine-rich repeat 162..189 CDD:275381 3/26 (12%)
leucine-rich repeat 202..220 CDD:275380 3/17 (18%)
leucine-rich repeat 223..251 CDD:275380 9/47 (19%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 9/29 (31%)
leucine-rich repeat 308..335 CDD:275380 8/29 (28%)
leucine-rich repeat 336..357 CDD:275380 6/20 (30%)
CIITAXP_006720943.2 NACHT 513..682 CDD:283404
LRR_RI 888..1213 CDD:238064 73/350 (21%)
leucine-rich repeat 1085..1112 CDD:275381 9/26 (35%)
leucine-rich repeat 1116..1154 CDD:275381 12/39 (31%)
leucine-rich repeat 1170..1200 CDD:275381 4/12 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.