DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and CG14325

DIOPT Version :10

Sequence 1:NP_610445.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_650641.2 Gene:CG14325 / 42123 FlyBaseID:FBgn0038531 Length:460 Species:Drosophila melanogaster


Alignment Length:404 Identity:89/404 - (22%)
Similarity:142/404 - (35%) Gaps:129/404 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 PKECPSPAAEKSRLFTILLLYCWQREYDKRP-YRQFQFKRLTFEERIGRRYHCIRDLRIIVNYLL 75
            |.|.......:::....|:|......:.:.| |||           :|||    .|.    ||||
  Fly    42 PSEDQEDQTNQAKSLRHLVLDSIVENWSELPLYRQ-----------LGRR----EDR----NYLL 87

  Fly    76 RR--PQLSVQISSLVVSNWDAGLLKDFV--RSLLPVW-------------YIELRLMRFPREFF- 122
            ..  .||.:|:.|       |.:.:||.  |.....|             :|.:.:.|..:||. 
  Fly    88 SHLDTQLPLQLLS-------AHIREDFFWQRCYGHRWRSAPLQARGRERPWINIYMERHVQEFIE 145

  Fly   123 --------------VMLRLNAAKMNVSQLSL--EGTPLTDEDVRILREFLLVS-KTLRRLNVSSC 170
                          |:|.:.||.:|..::|.  ...|.||.:..|..::||.: ..||:|.:|..
  Fly   146 NMPTGDYEQDGNVQVVLDICAAYINQLEISFLQPAPPTTDANDHIPLDYLLSNLPDLRQLRLSYS 210

  Fly   171 SLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTA 235
            :.|                   :..|..:|.:                             :||.
  Fly   211 TKT-------------------VGCNYQMGCN-----------------------------QLTV 227

  Fly   236 QDMIPIAEHLARTNSKFRRLRIAC---NKIGPDGAFFLLRGMSMG-GNLELLDLSYCSIGTHGGE 296
            :|::    ||.:..|:...||..|   .|:.|....||...:..| .:|..:.|.:|::|..|  
  Fly   228 RDIL----HLTKGLSQCHELRTFCLHNTKLMPYQLRFLAHSLDKGCHHLTEMSLLHCAVGDAG-- 286

  Fly   297 WVAKYLASCRR-----LQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRR 356
             :..:|.:|.:     |.||.|..|.:..... .||....:...||||.|..|...|..|..:..
  Fly   287 -IRCFLETCGKESFGTLTVLDLTNNKITEEGA-YILSRTLRHVPLEKLVLRLNPIQSDGAAAIFN 349

  Fly   357 LLDAEVVLHSELDI 370
            .|  :|:...|||:
  Fly   350 TL--QVMPIKELDL 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_610445.1 RNA1 <133..345 CDD:444072 48/223 (22%)
leucine-rich repeat 202..220 CDD:275380 0/17 (0%)
leucine-rich repeat 223..251 CDD:275380 5/27 (19%)
leucine-rich repeat 252..279 CDD:275380 8/30 (27%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 7/26 (27%)
leucine-rich repeat 336..357 CDD:275380 8/20 (40%)
CG14325NP_650641.2 RNA1 <185..434 CDD:444072 52/235 (22%)
leucine-rich repeat 202..239 CDD:275380 12/88 (14%)
leucine-rich repeat 240..271 CDD:275380 8/30 (27%)
leucine-rich repeat 272..301 CDD:275380 7/31 (23%)
leucine-rich repeat 302..326 CDD:275380 7/24 (29%)
leucine-rich repeat 329..353 CDD:275380 9/25 (36%)
leucine-rich repeat 356..383 CDD:275380 3/6 (50%)
leucine-rich repeat 384..407 CDD:275380
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.