DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and LRRC74B

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001277935.1 Gene:LRRC74B / 400891 HGNCID:34301 Length:392 Species:Homo sapiens


Alignment Length:337 Identity:76/337 - (22%)
Similarity:138/337 - (40%) Gaps:53/337 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 SNWDAGL-------LKDFVRSLLPVWYIELRLMR----FPREFFVMLRLNAAKMNVSQLSLEGTP 143
            :|||:.|       |.:.||..|     .||..|    .|...|  ||..:|:    :|:|....
Human    37 ANWDSDLETEGTDGLGELVRDTL-----YLRSCRAHSVVPISCF--LRQGSAQ----ELNLRHRG 90

  Fly   144 LTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVR--RLSANRL-------L 199
            |..:..|.|...|..:..::||::....|.......:|..:.||..:.  .||.|:|       |
Human    91 LGPQGARALASSLSSNPYVKRLDLRDNGLCGAGAEALAGALSKSSSIHDVDLSENQLGVAGAQAL 155

  Fly   200 GMSLSLD-------------TEKISSVLSSLLMQNT-LWALSLEHCELTAQDMIPIAEHLARTNS 250
            ..:|:::             .|:.:..|:.||:.:| |.:|.|.:.:|..|....:...||. |:
Human   156 CAALTVNQAMRKMQLSGNGLEEQAAQHLAELLLAHTDLKSLDLSYNQLNDQAGETLGPALAE-NT 219

  Fly   251 KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNY 315
            ....|.::.|.:...||....||:.....|::||:||...|..|...|.:.|.:...|:.|:::.
Human   220 GLTELNVSWNHLRGPGAVAFARGLEANIFLKVLDISYNGFGDPGASAVGEALKANNVLEELNMSN 284

  Fly   316 NDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAM-IVRRLLD-----AEVVLHSELDISYTY 374
            |.:.......:.|.::....|..|.:..|...|.... :::.:.|     .|::..|::.::..:
Human   285 NRISAMGALSLGLGLRVNQTLRILVVSRNPMRSEGCFGLLKSVQDNPASALELLDFSDIQVNAEF 349

  Fly   375 DEALQDYR-VVP 385
            |......| ::|
Human   350 DGLASSVRGILP 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 6/26 (23%)
LRR_RI 137..374 CDD:238064 57/265 (22%)
leucine-rich repeat 162..189 CDD:275381 6/26 (23%)
leucine-rich repeat 202..220 CDD:275380 5/30 (17%)
leucine-rich repeat 223..251 CDD:275380 8/27 (30%)
leucine-rich repeat 252..279 CDD:275380 6/26 (23%)
leucine-rich repeat 280..307 CDD:275380 9/26 (35%)
leucine-rich repeat 308..335 CDD:275380 4/26 (15%)
leucine-rich repeat 336..357 CDD:275380 4/21 (19%)
LRRC74BNP_001277935.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 24..46 4/8 (50%)
LRR_RI 57..357 CDD:238064 67/311 (22%)
LRR 1 106..129 3/22 (14%)
leucine-rich repeat 109..136 CDD:275380 6/26 (23%)
LRR 2 134..157 6/22 (27%)
leucine-rich repeat 137..164 CDD:275380 6/26 (23%)
LRR 3 162..185 2/22 (9%)
leucine-rich repeat 165..183 CDD:275380 1/17 (6%)
LRR 4 192..213 5/20 (25%)
leucine-rich repeat 193..220 CDD:275380 8/27 (30%)
LRR 5 220..241 4/20 (20%)
leucine-rich repeat 221..245 CDD:275380 6/23 (26%)
LRR 6 248..269 8/20 (40%)
leucine-rich repeat 249..276 CDD:275380 9/26 (35%)
LRR 7 276..297 3/20 (15%)
leucine-rich repeat 277..304 CDD:275380 4/26 (15%)
LRR 8 304..325 4/20 (20%)
leucine-rich repeat 305..334 CDD:275380 5/28 (18%)
LRR 9 334..356 3/21 (14%)
leucine-rich repeat 335..352 CDD:275380 3/16 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.