DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and CG18171

DIOPT Version :10

Sequence 1:NP_610445.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_647651.1 Gene:CG18171 / 38216 FlyBaseID:FBgn0035262 Length:760 Species:Drosophila melanogaster


Alignment Length:198 Identity:47/198 - (23%)
Similarity:81/198 - (40%) Gaps:35/198 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LRLMRFPREFFVMLRLNAAK--MNVSQLSLE--GTPL-----------TDEDVRILREFLLVSKT 161
            |:.:::|.:..|.:.|:..:  :|:..|:||  |..|           :.:|:..|...|:..:.
  Fly   355 LQQLKYPEDDCVHIDLSFVRHFVNLVSLNLEFLGPALGRKYHKRNVLFSIKDMVRLARGLVALQQ 419

  Fly   162 LRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLD------TEKISSVLSSLLMQ 220
            |:...:.:..|..|....:.            .|.|||.:...:|      |:.....|..||.:
  Fly   420 LQIFRLRNSRLNSFKLYTVC------------RALRLLPLLEVVDFGYNQMTDDCGPELGILLER 472

  Fly   221 -NTLWALSLEHCELTAQDMIPIAEHLARTN-SKFRRLRIACNKIGPDGAFFLLRGMSMGGNLELL 283
             ..|..|.||:..|..:.|..|.|.|.|.| |:...|.:|.||:..|....|..|:....::|.|
  Fly   473 PQMLKILELEYNRLDTRAMSAIGEALQRPNLSRLEYLGLAHNKLSGDSLSILCNGIKGTEHVEEL 537

  Fly   284 DLS 286
            ::|
  Fly   538 NVS 540

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_610445.1 RNA1 <133..345 CDD:444072 43/175 (25%)
leucine-rich repeat 202..220 CDD:275380 5/23 (22%)
leucine-rich repeat 223..251 CDD:275380 11/28 (39%)
leucine-rich repeat 252..279 CDD:275380 7/26 (27%)
leucine-rich repeat 280..307 CDD:275380 3/7 (43%)
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
CG18171NP_647651.1 LRR 332..>541 CDD:443914 47/198 (24%)
leucine-rich repeat 420..447 CDD:275380 7/38 (18%)
RNA1 <441..585 CDD:444072 31/100 (31%)
leucine-rich repeat 448..475 CDD:275380 5/26 (19%)
leucine-rich repeat 476..505 CDD:275380 11/28 (39%)
leucine-rich repeat 506..526 CDD:275380 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.