Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_789790.2 | Gene: | NLRP9 / 338321 | HGNCID: | 22941 | Length: | 991 | Species: | Homo sapiens |
Alignment Length: | 262 | Identity: | 71/262 - (27%) |
---|---|---|---|
Similarity: | 116/262 - (44%) | Gaps: | 21/262 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 AAKMNVSQLSLEGTPLTDEDVRILREFLLVSK-TLRRLNVSSCSLTQFNFALIADGVYKSPGVRR 192
Fly 193 LSANRLLGMSLSLDTEKISSVLSSL----LMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFR 253
Fly 254 RLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYND 317
Fly 318 MGPTAVNLILLAMK-KQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDISYTYDEALQDY 381
Fly 382 RV 383 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 11/27 (41%) |
LRR_RI | 137..374 | CDD:238064 | 67/243 (28%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 8/26 (31%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 4/21 (19%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 9/27 (33%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 9/26 (35%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 6/27 (22%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 7/20 (35%) | ||
NLRP9 | NP_789790.2 | Pyrin_NALPs | 11..93 | CDD:260032 | |
NACHT | 146..314 | CDD:310381 | |||
LRR_RI | 622..897 | CDD:330982 | 48/166 (29%) | ||
LRR 1 | 743..763 | 7/19 (37%) | |||
LRR 2 | 772..793 | 7/20 (35%) | |||
LRR 3 | 800..820 | 6/24 (25%) | |||
LRR 4 | 829..850 | 6/23 (26%) | |||
LRR 5 | 857..877 | 6/19 (32%) | |||
LRR 6 | 886..907 | 6/20 (30%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000189 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |