DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Lrrc71

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001101171.1 Gene:Lrrc71 / 310689 RGDID:1309453 Length:558 Species:Rattus norvegicus


Alignment Length:285 Identity:63/285 - (22%)
Similarity:112/285 - (39%) Gaps:69/285 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 YLLRRPQLSVQISSLVVSNWDAGLLKD-FVRSLLPVWYIELRLMR-FPREFFVMLRLNAAKMNVS 135
            |:..||.:.|::     ...|:..:|: ::|.    |.||.|::. |.:....:.:|.|  :|:.
  Rat   121 YVFFRPTIQVEL-----EQEDSKTVKEIYIRG----WKIEERILGIFSKCLPPLSQLQA--INLW 174

  Fly   136 QLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLG 200
            ::.|....||    ..:....|.|.|||::::....:.:.:|                  |:|:|
  Rat   175 KVGLTEKTLT----AFIALLPLCSPTLRKVSLEGNPIPEQSF------------------NKLMG 217

  Fly   201 MS-----LSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACN 260
            :.     |||....|:...:.||.|    |||..|                .:|.....|.:|.|
  Rat   218 LDSTIVHLSLRNNNINDHGAQLLGQ----ALSTLH----------------SSNRTLVSLNLAFN 262

  Fly   261 KIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNL 325
            .||.:||.::..|:.:..:|..|.|::..|...|...:|:.|   |..::.|..      .....
  Rat   263 HIGDEGAGYIADGLRLNRSLLWLSLAHNHIQDKGALKLAEVL---RPFELTHRE------VVERR 318

  Fly   326 ILLAMKKQCKLEKLTLYGNHFDSRT 350
            .||.:|...:..:......|.||:|
  Rat   319 RLLLVKGTQERSRSPSSSRHGDSKT 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 48/219 (22%)
leucine-rich repeat 162..189 CDD:275381 3/26 (12%)
leucine-rich repeat 202..220 CDD:275380 6/22 (27%)
leucine-rich repeat 223..251 CDD:275380 5/27 (19%)
leucine-rich repeat 252..279 CDD:275380 8/26 (31%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 4/26 (15%)
leucine-rich repeat 336..357 CDD:275380 4/15 (27%)
Lrrc71NP_001101171.1 LRR_RI <137..308 CDD:238064 50/221 (23%)
leucine-rich repeat 168..196 CDD:275380 8/33 (24%)
leucine-rich repeat 197..217 CDD:275380 5/37 (14%)
leucine-rich repeat 218..243 CDD:275380 7/28 (25%)
leucine-rich repeat 254..281 CDD:275380 8/26 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.