DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Lrrc31

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_006232300.2 Gene:Lrrc31 / 310256 RGDID:1561499 Length:487 Species:Rattus norvegicus


Alignment Length:430 Identity:90/430 - (20%)
Similarity:142/430 - (33%) Gaps:187/430 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 PQLSVQISSLVVSNWD---AGLLKDFVRSLLPVWYIELRLMRFPREFFVMLRLNAAKMNVSQL-- 137
            |.|| .:..|.|| |:   :|.|..|.:...||..::            :|||::.::....:  
  Rat    46 PLLS-DLEELDVS-WNDFVSGTLHSFTQQTHPVSKLK------------VLRLSSCRLTTEDVQT 96

  Fly   138 ---SLEGTPLTDE-------DV-----RILREFLLVSKTLRRLNVSSCSLT----QF-------- 175
               :||..|..:|       .|     ::|..|...|| :|.|.:..|:||    :|        
  Rat    97 LGGALELIPDLEELSLSWNSQVGGKLPQVLHTFQQGSK-IRTLELVDCALTPQDGEFVGHLLPKL 160

  Fly   176 ----------------NFALIADGVYKSPGVR----------------------RLSANRLLGMS 202
                            :..:||.|:..:||::                      .|.|.|:|.:|
  Rat   161 QSLEVFDLSNNRNIGSSLDIIAQGLKSTPGLKILKLHSCGLSPKSVRILDGAFAFLDALRILDLS 225

  Fly   203 LSLDTEK-ISSVLSSLLMQNTLWALSLEHCELTAQD------MIPIAEHLARTN----------- 249
            .:.:..: ...|.:.|.:...|..|.|..|.|||:|      ::|:..:|...:           
  Rat   226 CNKELGRGFEEVPARLALLKHLEVLDLHQCSLTAEDVTSLTQIVPLLSNLEELDLSSNRALGGSL 290

  Fly   250 -SKFRRLRIACNKIGPDGAFFLLRGMSM-----------------------------GGNLELLD 284
             |...|||..     |.....|:...::                             |||||||.
  Rat   291 ESLLSRLRFL-----PSLKSLLINSCALQRESFTALAEASVYLPALEILDLSWNKCVGGNLELLQ 350

  Fly   285 -------------LSYCSIGTHGGEWVA-----KYLASCRRLQVLHLNYNDMGPTAVNLILLAMK 331
                         ||.||:.|.....:|     .:||:   ||.|.|:||| |.......:.. :
  Rat   351 QTLNLSRSLRELRLSSCSLVTEDVALLALVMQTGHLAT---LQKLDLSYND-GICDAGWAIFC-Q 410

  Fly   332 KQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDIS 371
            ..|:|::||                          |||||
  Rat   411 NLCRLKELT--------------------------ELDIS 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 8/43 (19%)
LRR_RI 137..374 CDD:238064 75/368 (20%)
leucine-rich repeat 162..189 CDD:275381 9/54 (17%)
leucine-rich repeat 202..220 CDD:275380 3/18 (17%)
leucine-rich repeat 223..251 CDD:275380 10/45 (22%)
leucine-rich repeat 252..279 CDD:275380 6/55 (11%)
leucine-rich repeat 280..307 CDD:275380 12/44 (27%)
leucine-rich repeat 308..335 CDD:275380 8/26 (31%)
leucine-rich repeat 336..357 CDD:275380 3/20 (15%)
Lrrc31XP_006232300.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.