DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Nlrp4a

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001099690.1 Gene:Nlrp4a / 292545 RGDID:1561918 Length:982 Species:Rattus norvegicus


Alignment Length:425 Identity:96/425 - (22%)
Similarity:164/425 - (38%) Gaps:113/425 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 ILLLYCWQREYDKRPYRQFQFKRLTF-------EERIGRRYHCIRDL--------RIIVNYL--- 74
            |:..||.:..|        ..|:|:|       ||   ..:.|:.:|        .:::|..   
  Rat   585 IVAAYCLKHCY--------TLKKLSFSTQNILNEE---HEHSCMENLLTCWRHICSVLINSKDIQ 638

  Fly    75 --------LRRPQLSVQISSLVVSNWDAGLLKDFVRSLLPVWYIELRLMRFPREFFVMLR----- 126
                    |..|..||..:||...|   ..||..|.:  .|:::..:.:     ||.:::     
  Rat   639 ELQIKDTNLNEPAFSVLYNSLKYCN---DTLKVLVEN--NVFFLCEKYL-----FFELIQNCNLQ 693

  Fly   127 --------------------LNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSS-- 169
                                ||.|:.|:.:|.:....|:.:|.::....|:.||||::||:||  
  Rat   694 HLNLNLTFLSHSDVKLLCDVLNQAECNIEKLEVAACNLSPDDCKMFASILMSSKTLKQLNLSSNI 758

  Fly   170 --------------------------CSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTE 208
                                      |||:...:..::||:.::..:..|..:     |..|..|
  Rat   759 LGKGISSLCKSLCHPDCILEHLVLAKCSLSDQCWDYLSDGIRQNKTLNHLDIS-----SNDLKDE 818

  Fly   209 KISSVLSSLLMQNT-LWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLR 272
            .:..:..:|.:.|: |.:|.|.||.:|......:||.| |.|.....|:|:.|||...|...|..
  Rat   819 GLKVLCRALALPNSVLKSLCLRHCLITTSGCQDLAEVL-RNNQNLTSLQISYNKIEDAGVKLLCD 882

  Fly   273 GMSMGG-NLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQ-CK 335
            .:.... :||.|.|..|.:.....|.:|.....||.|..::|..|.:..|.:.::..|:::| |.
  Rat   883 AIKQPNCHLEDLGLEACELTGACCEDLASTFTQCRTLWGINLLNNTLDYTGLVVLCEALRQQKCT 947

  Fly   336 LEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDI 370
            ...|.|....||:.|    :..|.||...:.:|.|
  Rat   948 PHVLGLRITDFDNET----QAFLVAEQEKNPDLSI 978

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/26 (19%)
LRR_RI 137..374 CDD:238064 67/265 (25%)
leucine-rich repeat 162..189 CDD:275381 10/54 (19%)
leucine-rich repeat 202..220 CDD:275380 4/17 (24%)
leucine-rich repeat 223..251 CDD:275380 11/27 (41%)
leucine-rich repeat 252..279 CDD:275380 7/27 (26%)
leucine-rich repeat 280..307 CDD:275380 8/26 (31%)
leucine-rich repeat 308..335 CDD:275380 6/27 (22%)
leucine-rich repeat 336..357 CDD:275380 5/20 (25%)
Nlrp4aNP_001099690.1 Pyrin_NALPs 10..91 CDD:260032
NACHT 149..316 CDD:283404
LRR_RI 692..953 CDD:238064 62/266 (23%)
leucine-rich repeat 692..720 CDD:275381 3/27 (11%)
leucine-rich repeat 749..772 CDD:275380 5/22 (23%)
leucine-rich repeat 777..804 CDD:275380 5/26 (19%)
leucine-rich repeat 805..831 CDD:275380 5/30 (17%)
leucine-rich repeat 834..861 CDD:275380 11/27 (41%)
leucine-rich repeat 862..890 CDD:275380 7/27 (26%)
leucine-rich repeat 891..911 CDD:275380 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 1 1.000 - - oto96196
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.