Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157214.1 | Gene: | Nlrx1 / 270151 | MGIID: | 2429611 | Length: | 975 | Species: | Mus musculus |
Alignment Length: | 265 | Identity: | 59/265 - (22%) |
---|---|---|---|
Similarity: | 102/265 - (38%) | Gaps: | 54/265 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 102 RSLLP--------VWYIELRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLV 158
Fly 159 SK-TLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSLLMQNT 222
Fly 223 LWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSY 287
Fly 288 CSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAM 352
Fly 353 IVRRL 357 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 6/27 (22%) |
LRR_RI | 137..374 | CDD:238064 | 49/222 (22%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 4/17 (24%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 2/27 (7%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 6/26 (23%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 8/26 (31%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 8/20 (40%) | ||
Nlrx1 | NP_001157214.1 | P-loop_NTPase | 161..320 | CDD:304359 | |
LRR_RI | <698..903 | CDD:238064 | 52/234 (22%) | ||
leucine-rich repeat | 698..726 | CDD:275380 | 8/36 (22%) | ||
leucine-rich repeat | 727..748 | CDD:275380 | 5/20 (25%) | ||
leucine-rich repeat | 749..772 | CDD:275380 | 5/31 (16%) | ||
leucine-rich repeat | 773..808 | CDD:275380 | 10/61 (16%) | ||
leucine-rich repeat | 809..836 | CDD:275380 | 7/26 (27%) | ||
leucine-rich repeat | 837..864 | CDD:275380 | 8/26 (31%) | ||
leucine-rich repeat | 865..886 | CDD:275380 | 8/20 (40%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |