| Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_705773.2 | Gene: | Lrrc45 / 217366 | MGIID: | 2387183 | Length: | 670 | Species: | Mus musculus |
| Alignment Length: | 252 | Identity: | 70/252 - (27%) |
|---|---|---|---|
| Similarity: | 109/252 - (43%) | Gaps: | 22/252 - (8%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 137 LSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGM 201
Fly 202 SLSLDTEKISSVLSSLLMQN-TLWALSLEHCEL-TAQDMIPIAEHLARTNSKFRRLRIACNKIGP 264
Fly 265 DGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDMGPTAVNLILLA 329
Fly 330 MKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVV-LHSE-----LDISYTYDEALQD 380 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 8/23 (35%) |
| LRR_RI | 137..374 | CDD:238064 | 68/244 (28%) | ||
| leucine-rich repeat | 162..189 | CDD:275381 | 7/26 (27%) | ||
| leucine-rich repeat | 202..220 | CDD:275380 | 4/17 (24%) | ||
| leucine-rich repeat | 223..251 | CDD:275380 | 7/28 (25%) | ||
| leucine-rich repeat | 252..279 | CDD:275380 | 7/26 (27%) | ||
| leucine-rich repeat | 280..307 | CDD:275380 | 10/26 (38%) | ||
| leucine-rich repeat | 308..335 | CDD:275380 | 6/26 (23%) | ||
| leucine-rich repeat | 336..357 | CDD:275380 | 4/20 (20%) | ||
| Lrrc45 | NP_705773.2 | leucine-rich repeat | 30..55 | CDD:275380 | 7/19 (37%) |
| LRR_RI | <35..229 | CDD:393385 | 57/201 (28%) | ||
| LRR 1 | 59..79 | 6/19 (32%) | |||
| leucine-rich repeat | 60..87 | CDD:275380 | 7/26 (27%) | ||
| LRR 2 | 87..108 | 6/26 (23%) | |||
| leucine-rich repeat | 88..115 | CDD:275380 | 10/32 (31%) | ||
| LRR 3 | 115..136 | 6/20 (30%) | |||
| leucine-rich repeat | 116..145 | CDD:275380 | 7/28 (25%) | ||
| LRR 4 | 145..166 | 7/20 (35%) | |||
| leucine-rich repeat | 146..173 | CDD:275380 | 7/26 (27%) | ||
| LRR 5 | 173..194 | 8/20 (40%) | |||
| leucine-rich repeat | 174..201 | CDD:275380 | 10/26 (38%) | ||
| LRR 6 | 201..223 | 4/21 (19%) | |||
| SMC_prok_B | <267..608 | CDD:274008 | 1/6 (17%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 332..352 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||