Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001166250.1 | Gene: | LRRC34 / 151827 | HGNCID: | 28408 | Length: | 464 | Species: | Homo sapiens |
Alignment Length: | 251 | Identity: | 51/251 - (20%) |
---|---|---|---|
Similarity: | 104/251 - (41%) | Gaps: | 36/251 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 137 LSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANRLLGM 201
Fly 202 SLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIPIAEHLAR----------------TNS 250
Fly 251 KFRRLRIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRR-LQVLHLN 314
Fly 315 YNDMGPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDI 370 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 3/23 (13%) |
LRR_RI | 137..374 | CDD:238064 | 51/251 (20%) | ||
leucine-rich repeat | 162..189 | CDD:275381 | 5/26 (19%) | ||
leucine-rich repeat | 202..220 | CDD:275380 | 3/17 (18%) | ||
leucine-rich repeat | 223..251 | CDD:275380 | 5/43 (12%) | ||
leucine-rich repeat | 252..279 | CDD:275380 | 9/26 (35%) | ||
leucine-rich repeat | 280..307 | CDD:275380 | 9/26 (35%) | ||
leucine-rich repeat | 308..335 | CDD:275380 | 5/26 (19%) | ||
leucine-rich repeat | 336..357 | CDD:275380 | 5/20 (25%) | ||
LRRC34 | NP_001166250.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..48 | ||
LRR_RI | <147..396 | CDD:330982 | 48/230 (21%) | ||
leucine-rich repeat | 153..180 | CDD:275380 | |||
leucine-rich repeat | 181..208 | CDD:275380 | 3/23 (13%) | ||
leucine-rich repeat | 209..244 | CDD:275380 | 5/34 (15%) | ||
leucine-rich repeat | 268..295 | CDD:275380 | 3/26 (12%) | ||
LRR 1 | 295..315 | 8/19 (42%) | |||
leucine-rich repeat | 296..323 | CDD:275380 | 9/26 (35%) | ||
LRR 2 | 323..345 | 7/21 (33%) | |||
leucine-rich repeat | 324..352 | CDD:275380 | 9/27 (33%) | ||
leucine-rich repeat | 353..374 | CDD:275380 | 3/20 (15%) | ||
leucine-rich repeat | 375..402 | CDD:275380 | 7/26 (27%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 61 | 1.000 | Inparanoid score | I5393 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53944 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | oto89068 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.870 |