| Sequence 1: | NP_001286225.1 | Gene: | CG8197 / 35912 | FlyBaseID: | FBgn0033369 | Length: | 387 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_604393.2 | Gene: | NLRP4 / 147945 | HGNCID: | 22943 | Length: | 994 | Species: | Homo sapiens |
| Alignment Length: | 330 | Identity: | 85/330 - (25%) |
|---|---|---|---|
| Similarity: | 140/330 - (42%) | Gaps: | 41/330 - (12%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 75 LRRPQLSVQISSLVVSN----WDAGLLKDFVRSLLPVWYIELRLMRFPREFFVML--RLNAAKMN 133
Fly 134 VSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGV-------------- 184
Fly 185 ---------YKSPGVRRLSANRLLGMSLS-LDTEKISSVLSSLLMQN-TLWALSLEHCELTAQDM 238
Fly 239 IPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMS-MGGNLELLDLSYCSIGTHGGEWVAKYL 302
Fly 303 ASCRRLQVLHLNYNDMGPTAVNLILLAMK-KQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHS 366
Fly 367 ELDIS 371 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG8197 | NP_001286225.1 | leucine-rich repeat | 134..161 | CDD:275381 | 7/26 (27%) |
| LRR_RI | 137..374 | CDD:238064 | 69/262 (26%) | ||
| leucine-rich repeat | 162..189 | CDD:275381 | 9/49 (18%) | ||
| leucine-rich repeat | 202..220 | CDD:275380 | 4/18 (22%) | ||
| leucine-rich repeat | 223..251 | CDD:275380 | 9/27 (33%) | ||
| leucine-rich repeat | 252..279 | CDD:275380 | 9/27 (33%) | ||
| leucine-rich repeat | 280..307 | CDD:275380 | 7/26 (27%) | ||
| leucine-rich repeat | 308..335 | CDD:275380 | 8/27 (30%) | ||
| leucine-rich repeat | 336..357 | CDD:275380 | 6/20 (30%) | ||
| NLRP4 | NP_604393.2 | Pyrin_NALPs | 11..92 | CDD:260032 | |
| AAA | 147..279 | CDD:214640 | |||
| NACHT | 149..318 | CDD:283404 | |||
| CS_ACL-C_CCL | 512..>570 | CDD:294291 | |||
| LRR_RI | <630..733 | CDD:238064 | 18/72 (25%) | ||
| LRR 1 | 637..660 | ||||
| leucine-rich repeat | 640..668 | CDD:275380 | 4/7 (57%) | ||
| leucine-rich repeat | 669..695 | CDD:275380 | 4/25 (16%) | ||
| leucine-rich repeat | 696..724 | CDD:275380 | 6/27 (22%) | ||
| LRR 2 | 698..721 | 6/22 (27%) | |||
| LRR 3 | 722..745 | 7/22 (32%) | |||
| LRR_RI | 724..957 | CDD:238064 | 61/234 (26%) | ||
| leucine-rich repeat | 725..752 | CDD:275380 | 7/26 (27%) | ||
| LRR 4 | 750..777 | 8/27 (30%) | |||
| leucine-rich repeat | 753..780 | CDD:275380 | 7/27 (26%) | ||
| leucine-rich repeat | 781..808 | CDD:275380 | 3/26 (12%) | ||
| LRR 5 | 806..833 | 6/26 (23%) | |||
| leucine-rich repeat | 809..833 | CDD:275380 | 6/23 (26%) | ||
| leucine-rich repeat | 838..865 | CDD:275380 | 9/27 (33%) | ||
| LRR 6 | 863..886 | 9/22 (41%) | |||
| leucine-rich repeat | 895..922 | CDD:275381 | 7/26 (27%) | ||
| LRR 7 | 920..943 | 7/22 (32%) | |||
| LRR 8 | 949..972 | 9/26 (35%) | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_KOG4308 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 1 | 1.000 | - | - | FOG0000189 | |
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||