DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Rnh1

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001165572.1 Gene:Rnh1 / 107702 MGIID:1195456 Length:492 Species:Mus musculus


Alignment Length:343 Identity:85/343 - (24%)
Similarity:139/343 - (40%) Gaps:64/343 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 TFEERIGRRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDFVRSLLPV--WYIELRL 114
            |::....||.||...:           .|.:|...|..:.|         ..|||:  .|..:||
Mouse    22 TWQSGWTRRLHCAPTM-----------SLDIQCEQLSDARW---------TELLPLIQQYEVVRL 66

  Fly   115 -------MRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLL-VSKTLRRLNVSSCS 171
                   :|. ::....::.|.|   :::|||....|.|..|.::.:.|. .:..:::|::.:|.
Mouse    67 DDCGLTEVRC-KDISSAVQANPA---LTELSLRTNELGDGGVGLVLQGLQNPTCKIQKLSLQNCG 127

  Fly   172 LTQFNFALIADGVYKSPG-VRRLSANRLLGMSLSLDTEKISSVLSSLLM------QNTLWALSLE 229
            ||:....::       || :|.||..|    .|.|:...:......||.      |..|..|.||
Mouse   128 LTEAGCGIL-------PGMLRSLSTLR----ELHLNDNPMGDAGLKLLCEGLQDPQCRLEKLQLE 181

  Fly   230 HCELTAQDMIPIAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIGTH 293
            :|.|||....|:|..| |..:.|:.|.::.|.:...|...|.:|:.... .||.|.|..|.|...
Mouse   182 YCNLTATSCEPLASVL-RVKADFKELVLSNNDLHEPGVRILCQGLKDSACQLESLKLENCGITAA 245

  Fly   294 GGEWVAKYLASCRRLQVLHLNYNDMGPTAV-----NLILLAMKKQCKLEKLTLYGNHFDSRTAMI 353
            ..:.:...:||...||.|.|:.|.:|...:     .|:|    ..|||..|.|:.....:.....
Mouse   246 NCKDLCDVVASKASLQELDLSSNKLGNAGIAALCPGLLL----PSCKLRTLWLWECDITAEGCKD 306

  Fly   354 VRRLLDAEVVLHSELDIS 371
            :.|:|.|:..| .||.::
Mouse   307 LCRVLRAKQSL-KELSLA 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 7/27 (26%)
LRR_RI 137..374 CDD:238064 67/249 (27%)
leucine-rich repeat 162..189 CDD:275381 4/26 (15%)
leucine-rich repeat 202..220 CDD:275380 4/23 (17%)
leucine-rich repeat 223..251 CDD:275380 12/27 (44%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 8/26 (31%)
leucine-rich repeat 308..335 CDD:275380 8/31 (26%)
leucine-rich repeat 336..357 CDD:275380 3/20 (15%)
Rnh1NP_001165572.1 LRR_RI 37..356 CDD:238064 80/328 (24%)
leucine-rich repeat 38..60 CDD:275380 7/30 (23%)
LRR <46..361 CDD:227223 78/308 (25%)
leucine-rich repeat 61..88 CDD:275380 5/27 (19%)
leucine-rich repeat 89..113 CDD:275380 7/23 (30%)
leucine-rich repeat 118..145 CDD:275380 8/33 (24%)
leucine-rich repeat 146..174 CDD:275380 6/31 (19%)
leucine-rich repeat 175..198 CDD:275380 11/23 (48%)
leucine-rich repeat 203..231 CDD:275380 6/27 (22%)
leucine-rich repeat 232..259 CDD:275380 8/26 (31%)
leucine-rich repeat 260..288 CDD:275380 8/31 (26%)
leucine-rich repeat 289..309 CDD:275380 3/19 (16%)
leucine-rich repeat 317..336 CDD:275380 3/8 (38%)
leucine-rich repeat 346..373 CDD:275380
LRR_RI 371..398 CDD:197686
leucine-rich repeat 374..397 CDD:275380
leucine-rich repeat 403..430 CDD:275380
LRR_RI 428..455 CDD:197686
leucine-rich repeat 431..452 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53944
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.