DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Nlrp4b

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_038951962.1 Gene:Nlrp4b / 100912013 RGDID:1559894 Length:861 Species:Rattus norvegicus


Alignment Length:245 Identity:63/245 - (25%)
Similarity:106/245 - (43%) Gaps:51/245 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 QFKRLTFEERIGRRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDFVRSLLPVWYIE 111
            |.|...|.|.:         .:|:.|||    :.|..|..::|:| |...|.|        .|: 
  Rat   633 QMKDTIFNEPV---------FQILYNYL----KNSSCILEVLVAN-DVSFLCD--------KYL- 674

  Fly   112 LRLMRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLLVSK-TLRRLNVSSCSLTQF 175
                     ||.:::    ..|:..|.|.||.|:..||.||...|..:: .::.|.:::|||::.
  Rat   675 ---------FFDLIQ----SYNLELLDLSGTFLSHSDVVILCNILNKAEYKIQELELANCSLSEQ 726

  Fly   176 NFALIADGVYKSPGVRRLSANRLLGMSLSLDTEKISSVLSSL-LMQNTLWALSLEHCELTAQDMI 239
            ::..|:|.:.::..:|.|..:     |..|..|.:..:..:| |..:.|..||||.||||.    
  Rat   727 SWKYISDVLCQNKTLRHLDIS-----SNDLKDEGLKVLCKALTLPDSVLLTLSLEACELTG---- 782

  Fly   240 PIAEHLARTNSKFRRL---RIACNKIGPDGAFFLLRGMSM-GGNLELLDL 285
            ...|.||.|.::.:.|   .:..|.:..:|...|.:.:.. ..||:.|.|
  Rat   783 ACCEDLASTFTQCKTLGWINLVKNALDFNGLVVLCKALKQKTSNLKELRL 832

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 10/27 (37%)
LRR_RI 137..374 CDD:238064 44/155 (28%)
leucine-rich repeat 162..189 CDD:275381 6/26 (23%)
leucine-rich repeat 202..220 CDD:275380 5/18 (28%)
leucine-rich repeat 223..251 CDD:275380 13/27 (48%)
leucine-rich repeat 252..279 CDD:275380 4/30 (13%)
leucine-rich repeat 280..307 CDD:275380 3/6 (50%)
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
Nlrp4bXP_038951962.1 Pyrin_NALPs 10..93 CDD:260032
NACHT 144..311 CDD:399032
NOD2_WH 388..444 CDD:407651
NLRC4_HD2 446..558 CDD:407648
LRR_RI 619..855 CDD:423007 63/245 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.