DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and tcte1

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_002942200.2 Gene:tcte1 / 100487694 XenbaseID:XB-GENE-996398 Length:460 Species:Xenopus tropicalis


Alignment Length:219 Identity:60/219 - (27%)
Similarity:94/219 - (42%) Gaps:43/219 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 LRLMRFPREFFVMLRLNAAKMN----------------VSQLSLEGTPLTDEDVRILREFLLVSK 160
            ||:.|..:.|    ||:.:|::                :..|.|....::|...|.:.: ||...
 Frog   246 LRVFRNLKVF----RLHKSKVDDDKACVLVRSLLNHPALVHLDLSHNQVSDRGARAIAK-LLKES 305

  Fly   161 TLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANR--LLGMSLSLD---TEKISSVLSSLLMQ 220
            .||.|::|:.::          |.:.:..:.....|.  |..:||.|:   .|...::.::||..
 Frog   306 ALRVLDLSNNNV----------GAHGAQALAHALTNNWTLRNLSLRLNHVGNEGGQALCNALLPN 360

  Fly   221 NTLWALSLEHCELTAQDMIPIAEHLART---NSKFRRLRIACNKIGPDGAFFLLRGMSMGGNLEL 282
            .||..|.|...||:.    |.|..|::.   |...|||.:|||:|||||...||.|||....|..
 Frog   361 QTLQELHLGSNELSE----PTASALSQALTHNGSLRRLSLACNRIGPDGGKQLLEGMSDNETLLE 421

  Fly   283 LDLSYCSIGTHGGEWVAKYLASCR 306
            |||....||.....::.:.|.:.|
 Frog   422 LDLRLTEIGQESEFFINQVLKNNR 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 6/26 (23%)
LRR_RI 137..374 CDD:238064 53/178 (30%)
leucine-rich repeat 162..189 CDD:275381 5/26 (19%)
leucine-rich repeat 202..220 CDD:275380 6/20 (30%)
leucine-rich repeat 223..251 CDD:275380 9/30 (30%)
leucine-rich repeat 252..279 CDD:275380 16/26 (62%)
leucine-rich repeat 280..307 CDD:275380 8/27 (30%)
leucine-rich repeat 308..335 CDD:275380
leucine-rich repeat 336..357 CDD:275380
tcte1XP_002942200.2 LRR_RI 152..448 CDD:238064 60/219 (27%)
leucine-rich repeat 280..306 CDD:275380 6/26 (23%)
leucine-rich repeat 307..331 CDD:275380 5/33 (15%)
leucine-rich repeat 335..360 CDD:275380 7/24 (29%)
leucine-rich repeat 363..390 CDD:275380 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.