DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and Rnh1

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001257691.1 Gene:Rnh1 / 100360501 RGDID:621398 Length:492 Species:Rattus norvegicus


Alignment Length:352 Identity:87/352 - (24%)
Similarity:139/352 - (39%) Gaps:76/352 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 RRYHCIRDLRIIVNYLLRRPQLSVQISSLVVSNWDAGLLKDFVRSLLPV--WYIELRL------- 114
            ||.||...:           .|.:|...|..:.|         ..|||:  .|..:||       
  Rat    29 RRLHCAPTM-----------SLDIQCEQLSDARW---------TELLPLIQQYQVVRLDDCGLTE 73

  Fly   115 MRFPREFFVMLRLNAAKMNVSQLSLEGTPLTDEDVRILREFLL-VSKTLRRLNVSSCSLTQFNFA 178
            :|. ::....::.|.|   :::|||....|.|..|.::.:.|. .:..:::|::.:||||:....
  Rat    74 VRC-KDIRSAIQANPA---LTELSLRTNELGDAGVGLVLQGLQNPTCKIQKLSLQNCSLTEAGCG 134

  Fly   179 LIADGVYKSPGVRR---LSANRLLGMSLSLDTEKISSVLSSLLMQNTLWALSLEHCELTAQDMIP 240
            ::.| |.:|....|   |:.|.|....|.|..|.:..      .|..|..|.||:|.|||....|
  Rat   135 VLPD-VLRSLSTLRELHLNDNPLGDEGLKLLCEGLRD------PQCRLEKLQLEYCNLTATSCEP 192

  Fly   241 IAEHLARTNSKFRRLRIACNKIGPDGAFFLLRGMSMGG-NLELLDLSYCSIGTHGGEWVAKYLAS 304
            :|..| |....|:.|.::.|.....|...|.:|:.... .||.|.|..|.|.:...:.:...:||
  Rat   193 LASVL-RVKPDFKELVLSNNDFHEAGIHTLCQGLKDSACQLESLKLENCGITSANCKDLCDVVAS 256

  Fly   305 CRRLQVLHLNYNDMGPTAV-----NLILLAMK-------------KQCK-----------LEKLT 340
            ...||.|.|..|.:|.|.:     .|:|.:.:             :.||           |::|:
  Rat   257 KASLQELDLGSNKLGNTGIAALCSGLLLPSCRLRTLWLWDCDVTAEGCKDLCRVLRAKQSLKELS 321

  Fly   341 LYGNHF-DSRTAMIVRRLLDAEVVLHS 366
            |.||.. |....::...||:....|.|
  Rat   322 LAGNELKDEGAQLLCESLLEPGCQLES 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 7/27 (26%)
LRR_RI 137..374 CDD:238064 70/265 (26%)
leucine-rich repeat 162..189 CDD:275381 8/26 (31%)
leucine-rich repeat 202..220 CDD:275380 3/17 (18%)
leucine-rich repeat 223..251 CDD:275380 12/27 (44%)
leucine-rich repeat 252..279 CDD:275380 6/27 (22%)
leucine-rich repeat 280..307 CDD:275380 8/26 (31%)
leucine-rich repeat 308..335 CDD:275380 9/44 (20%)
leucine-rich repeat 336..357 CDD:275380 6/21 (29%)
Rnh1NP_001257691.1 LRR_RI 37..356 CDD:238064 83/344 (24%)
leucine-rich repeat 38..60 CDD:275380 7/30 (23%)
LRR <46..361 CDD:227223 81/324 (25%)
leucine-rich repeat 61..88 CDD:275380 5/27 (19%)
leucine-rich repeat 89..113 CDD:275380 7/23 (30%)
leucine-rich repeat 118..145 CDD:275380 8/27 (30%)
leucine-rich repeat 146..174 CDD:275380 8/33 (24%)
leucine-rich repeat 175..202 CDD:275380 12/27 (44%)
leucine-rich repeat 203..231 CDD:275380 6/27 (22%)
leucine-rich repeat 232..259 CDD:275380 8/26 (31%)
leucine-rich repeat 260..288 CDD:275380 9/27 (33%)
leucine-rich repeat 289..309 CDD:275380 2/19 (11%)
leucine-rich repeat 317..336 CDD:275380 6/18 (33%)
LRR_RI 318..>465 CDD:238064 9/31 (29%)
leucine-rich repeat 374..402 CDD:275380
leucine-rich repeat 403..430 CDD:275380
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4308
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53944
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000189
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.