DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and lrrc34

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:NP_001106443.1 Gene:lrrc34 / 100127617 XenbaseID:XB-GENE-998066 Length:409 Species:Xenopus tropicalis


Alignment Length:253 Identity:63/253 - (24%)
Similarity:117/253 - (46%) Gaps:11/253 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 AAKMNVSQLSLE--GTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVR 191
            |...|.:.|||.  |..:.::...:....|.::.||..|::..|.|...:...:|..:.::..::
 Frog   122 ALHRNTTLLSLRMTGDKIGNKGGMLFASMLQINSTLEELDLGDCDLGIQSLIALATVLLQNKTLK 186

  Fly   192 RLSANRLLGMSLSLDTEKISSVLSSLLMQN-TLWALSLEHCELTAQDMIPIAEHLARTNSKFRRL 255
            .|:.||.:...:..||   :..||.:|..| ||..|.|...|:|...:..:.:.| ..|...:.|
 Frog   187 SLNLNRPIFYVMQEDT---TVHLSEMLRVNSTLQELHLSKHEITDFGVQRLCDAL-HENHTLKYL 247

  Fly   256 RIACNKIGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAK--YLASCRRLQVLHLNYNDM 318
            .::||||..||..:|...:.:...||:|||:...:...|..::|:  ||.: |.|:.|.:..|::
 Frog   248 NLSCNKITRDGVKYLAEVLKINKTLEILDLASNRMEDDGALYLAEAIYLYN-RSLKALSVVSNNI 311

  Fly   319 GPTAVNLILLAMKKQCKLEKLTLYGNHFDSRTAMIVRRLLDAEVVLHSELDIS-YTYD 375
            ....:..:..|:|....|..:.::||..:...:|...:||.:..:..|..|:. |..|
 Frog   312 SGKGLQALAAAIKANNCLLYIYIWGNKINQEASMAFSQLLQSGRLSSSSTDVQPYVVD 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 5/28 (18%)
LRR_RI 137..374 CDD:238064 60/242 (25%)
leucine-rich repeat 162..189 CDD:275381 5/26 (19%)
leucine-rich repeat 202..220 CDD:275380 5/17 (29%)
leucine-rich repeat 223..251 CDD:275380 7/27 (26%)
leucine-rich repeat 252..279 CDD:275380 8/26 (31%)
leucine-rich repeat 280..307 CDD:275380 9/28 (32%)
leucine-rich repeat 308..335 CDD:275380 5/26 (19%)
leucine-rich repeat 336..357 CDD:275380 4/20 (20%)
lrrc34NP_001106443.1 LRR_RI 64..342 CDD:393385 56/224 (25%)
leucine-rich repeat 157..184 CDD:275381 5/26 (19%)
leucine-rich repeat 185..215 CDD:275381 9/32 (28%)
leucine-rich repeat 216..240 CDD:275381 6/24 (25%)
leucine-rich repeat 244..271 CDD:275381 8/26 (31%)
leucine-rich repeat 272..300 CDD:275381 9/28 (32%)
leucine-rich repeat 329..352 CDD:275380 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5210
OMA 1 1.010 - - QHG53944
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto102930
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.