DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8197 and cep78

DIOPT Version :9

Sequence 1:NP_001286225.1 Gene:CG8197 / 35912 FlyBaseID:FBgn0033369 Length:387 Species:Drosophila melanogaster
Sequence 2:XP_031751460.1 Gene:cep78 / 100037836 XenbaseID:XB-GENE-5884411 Length:763 Species:Xenopus tropicalis


Alignment Length:190 Identity:46/190 - (24%)
Similarity:82/190 - (43%) Gaps:18/190 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 NVSQLSLEGTPLTDEDVRILREFLLVSKTLRRLNVSSCSLTQFNFALIADGVYKSPGVRRLSANR 197
            ::.:|.|.|.||.:.|:|||.:.|..|.::..|:::.||.......:|...|..||.::.::   
 Frog   122 SLKELELHGLPLRERDLRILAKGLAASSSVESLSLAYCSCGDEGLEIICQSVKNSPTIKTVN--- 183

  Fly   198 LLGMSLS-LDTEKISSVL--SSLLMQNTLWALSLEHCELTAQDMIPIAEHLARTNSKFRRLRIAC 259
            ..|.:|: ...|.|:|::  .:....:..||.||.:..       |..:.:|    ..||:.:..
 Frog   184 FTGCNLTWRGAEHIASIIKHQATRRHSEAWAESLRYRR-------PDLDCMA----GLRRVTLNS 237

  Fly   260 NK-IGPDGAFFLLRGMSMGGNLELLDLSYCSIGTHGGEWVAKYLASCRRLQVLHLNYNDM 318
            |. :|..||..|...:.....|:.|||..|.|...|.:.......:...|.:|.:..|.:
 Frog   238 NTLVGDRGAIALAEVIGEDLWLKALDLRQCGISNEGAQAFLNAFQTNTTLIILDIRRNPL 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8197NP_001286225.1 leucine-rich repeat 134..161 CDD:275381 11/26 (42%)
LRR_RI 137..374 CDD:238064 46/186 (25%)
leucine-rich repeat 162..189 CDD:275381 6/26 (23%)
leucine-rich repeat 202..220 CDD:275380 4/20 (20%)
leucine-rich repeat 223..251 CDD:275380 6/27 (22%)
leucine-rich repeat 252..279 CDD:275380 7/27 (26%)
leucine-rich repeat 280..307 CDD:275380 7/26 (27%)
leucine-rich repeat 308..335 CDD:275380 3/11 (27%)
leucine-rich repeat 336..357 CDD:275380
cep78XP_031751460.1 LRR_RI <110..275 CDD:423007 43/166 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.