DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment PPO2 and AgaP_AGAP010658

DIOPT Version :9

Sequence 1:NP_610443.1 Gene:PPO2 / 35910 FlyBaseID:FBgn0033367 Length:684 Species:Drosophila melanogaster
Sequence 2:XP_001237381.1 Gene:AgaP_AGAP010658 / 4577701 VectorBaseID:AGAP010658 Length:218 Species:Anopheles gambiae


Alignment Length:166 Identity:40/166 - (24%)
Similarity:70/166 - (42%) Gaps:26/166 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ADKKNLL---LLFD---HPTEPVFMDKGKRVTVFDVPDSFLTDRYRPISNEVQSRVGDKVEQRVP 60
            |||:.|:   ..|:   |..:|:..::....|...|.|......|..::..:|:     .||.| 
Mosquito    38 ADKEFLVKQKFFFEILRHLHQPIAFEEYLPYTSRWVTDPSKYTNYTEVAEFIQT-----YEQGV- 96

  Fly    61 VREISIPDLRIPMSLGRDEQFSLFLPKHRRIAGRLIDIFMNMRSVDDLQSVAVYARDRVNPVLFN 125
                          |.:.:.|:::...:.:...:|...|.|....|......|:||..:|..:|.
Mosquito    97 --------------LKKGQIFTIYNYWYAKETVQLYRFFENAIDWDTYYKNVVWARANLNEGMFL 147

  Fly   126 YALSVALLHRPDTQGLDLPSFSQTFPDRFIDSQVIR 161
            .||::::|||.|.||:.||:..:..|..|.|..|.:
Mosquito   148 SALTLSVLHRKDLQGIVLPAIYEIHPHLFFDGDVFQ 183

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PPO2NP_610443.1 Hemocyanin_N 19..140 CDD:281684 25/120 (21%)
Hemocyanin_M 150..412 CDD:278784 4/12 (33%)
Hemocyanin_C 421..675 CDD:281685
AgaP_AGAP010658XP_001237381.1 Hemocyanin_N 42..162 CDD:281684 29/139 (21%)
Hemocyanin_M 169..>214 CDD:278784 4/15 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.