DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and PRSS27

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_114154.1 Gene:PRSS27 / 83886 HGNCID:15475 Length:290 Species:Homo sapiens


Alignment Length:261 Identity:91/261 - (34%)
Similarity:140/261 - (53%) Gaps:18/261 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 SCGISLAKQTAQRRIVGGDDAGFGSFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCVARATPRQV 661
            :||    :.....|:|||.|...|.:|||..| |.||..||||||:.:.|:||.||....:...:
Human    25 ACG----RPRMLNRMVGGQDTQEGEWPWQVSIQRNGSHFCGGSLIAEQWVLTAAHCFRNTSETSL 85

  Fly   662 H-VTLGDYVINSAVEPLPAYTFG-VRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICL 724
            : |.||   ....|:|.|...:. ||:::.:|.::.|  |...|::::.||..|.|..:|.|:||
Human    86 YQVLLG---ARQLVQPGPHAMYARVRQVESNPLYQGT--ASSADVALVELEAPVPFTNYILPVCL 145

  Fly   725 PEKNEDF-LGKFGWAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQN---GIN-VVIYQ 783
            |:.:..| .|...|..|||:.:....| .|:.||.:.||:|:...|...:.::   |.. ..|..
Human   146 PDPSVIFETGMNCWVTGWGSPSEEDLLPEPRILQKLAVPIIDTPKCNLLYSKDTEFGYQPKTIKN 210

  Fly   784 EMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYV 848
            :|||||:..|.||:|:|||||||:......|...||:|.|..||.:.:||:|..|:...:|:..:
Human   211 DMLCAGFEEGKKDACKGDSGGPLVCLVGQSWLQAGVISWGEGCARQNRPGVYIRVTAHHNWIHRI 275

  Fly   849 V 849
            :
Human   276 I 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 88/242 (36%)
Tryp_SPc 612..846 CDD:238113 88/242 (36%)
PRSS27NP_114154.1 Tryp_SPc 34..272 CDD:214473 88/242 (36%)
Tryp_SPc 36..275 CDD:238113 88/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.