DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and prss60.1

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001082915.1 Gene:prss60.1 / 799770 ZFINID:ZDB-GENE-070424-25 Length:387 Species:Danio rerio


Alignment Length:264 Identity:92/264 - (34%)
Similarity:125/264 - (47%) Gaps:33/264 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 CGISLAKQTAQRRIVGGDDAGFGSFPWQAYIR---IGSSRCGGSLISRRHVVTAGHCVARATPRQ 660
            ||::    ....|||||.:|..||:|||..:.   .|...||||||:...|:||.||:.|.|...
Zfish    25 CGLA----PLNNRIVGGVNAFDGSWPWQVSLHSPIYGGHFCGGSLINSEWVLTAAHCLPRITTSS 85

  Fly   661 VHVTLG--------DYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMP 717
            :.|.||        .|.||..|..          |.|||  .:....:..||::|.|...|.|..
Zfish    86 LLVFLGKTTQQGVNTYEINRTVSV----------ITVHP--SYNNLTNENDIALLHLSSAVTFSN 138

  Fly   718 HIAPICLPEKNEDF-LGKFGWAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNGINVV 780
            :|.|:||..:|..| .|...|..|||.:..|..| .|..||...:||:.|..|........:.  
Zfish   139 YIRPVCLAAQNSVFPNGTSSWITGWGNIQLGVNLPAPGILQETMIPVVPNDQCNALLGSGSVT-- 201

  Fly   781 IYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
              ..|:|||...||:|:||||||||::..:...|...|:.|.||.||....||:|..||:...|:
Zfish   202 --NNMICAGLLQGGRDTCQGDSGGPMVSKQCLVWVQSGITSWGYGCADPYSPGVYTRVSQYQSWI 264

  Fly   846 SYVV 849
            :.::
Zfish   265 NSII 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 89/246 (36%)
Tryp_SPc 612..846 CDD:238113 89/246 (36%)
prss60.1NP_001082915.1 Tryp_SPc 33..264 CDD:214473 89/246 (36%)
Tryp_SPc 34..267 CDD:238113 89/248 (36%)
Somatomedin_B 349..382 CDD:295334
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.