DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and tmprss4a

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005157547.1 Gene:tmprss4a / 777630 ZFINID:ZDB-GENE-061103-631 Length:458 Species:Danio rerio


Alignment Length:405 Identity:120/405 - (29%)
Similarity:170/405 - (41%) Gaps:77/405 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   486 LAAVQDVRNDYSLQDLDSASEATSSPQSASTFKEKV-------------DITTDTEC------QH 531
            |..|.|.:||.|..:.:||......|.  :||..::             |.|..:.|      ||
Zfish    86 LEKVCDGKNDCSEAEDESACVTMFKPN--TTFPLRLYSANNVLQVLSPSDNTWKSVCSESFTQQH 148

  Fly   532 RGGTCEFFLGCWLS---GGLIQG--TCDGLLRGCCHRTAKSANLGS--SD----FVGNAVDLTDL 585
            ....|: .||..:|   ..:..|  ..|..:..|...|.|.....|  ||    ..|..:.|   
Zfish   149 AETACQ-LLGYSVSPVFSSIAVGPLPSDLKISFCMVGTTKPQTFQSAVSDRKVCSTGTVISL--- 209

  Fly   586 PQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI-GSSRCGGSLISRRHVVTA 649
                        ||.........|.|||||.||...::|||..::. |...|||||::...||||
Zfish   210 ------------SCSADCGLSRNQDRIVGGKDADIANWPWQVSLQYSGQHTCGGSLVTPNWVVTA 262

  Fly   650 GHCV----ARATPRQVHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLE 710
            .||.    .:|..|...|:...|:.::.    .:|   |:.|.|:..:|  |....|||:::.|:
Zfish   263 AHCFNGDGRKALSRWTVVSGITYLSSTP----SSY---VKEIIVNSNYK--PAESDFDITMIKLQ 318

  Fly   711 RTVHFMPHIAPICLPEKNEDFLGKFGW-AAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQ 774
            ..:.......|:|||.:|....|..|. ..|||.:..........||...:.||::..|.     
Zfish   319 SPITLSESRRPVCLPPQNLGLKGGDGLVVTGWGHMAEKGGSLSSMLQKAQIQVIDSAQCS----- 378

  Fly   775 NGINVVIY-----QEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGI 834
               :..:|     ..|:|||...||.|:|||||||||:|..: ||.|:||||.|..||..|.||:
Zfish   379 ---SPTVYGSSITPRMICAGVMAGGVDACQGDSGGPLVHLAD-RWVLVGVVSWGVGCARPGFPGV 439

  Fly   835 YHSVSKTVDWVSYVV 849
            |.:|.:.:||...|:
Zfish   440 YTNVDQMLDWAHSVM 454

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 85/244 (35%)
Tryp_SPc 612..846 CDD:238113 85/244 (35%)
tmprss4aXP_005157547.1 LDLa 74..105 CDD:238060 7/18 (39%)
SRCR_2 121..218 CDD:295335 21/112 (19%)
Tryp_SPc 223..449 CDD:214473 84/243 (35%)
Tryp_SPc 224..449 CDD:238113 83/242 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.