DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Prss22

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_006524968.4 Gene:Prss22 / 70835 MGIID:1918085 Length:365 Species:Mus musculus


Alignment Length:274 Identity:97/274 - (35%)
Similarity:143/274 - (52%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 LTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPW-QAYIRIGSSRCGGSLISRRH 645
            ||.....:...:...|.||    |.....|||||:|:....:|| .:.::.||..|.|||::.|.
Mouse    82 LTSTAPISAATIRVSPDCG----KPQQLNRIVGGEDSMDAQWPWIVSILKNGSHHCAGSLLTNRW 142

  Fly   646 VVTAGHCVA--RATPRQVHVTLGDYVINSAVEPLP-AYTFGVRRIDVHPYFKFTPQADRFDISVL 707
            ||||.||..  ...|....|.||.:.:.|   |.| :...|:..:..||.:.: .:....||:::
Mouse   143 VVTAAHCFKSNMDKPSLFSVLLGAWKLGS---PGPRSQKVGIAWVLPHPRYSW-KEGTHADIALV 203

  Fly   708 TLERTVHFMPHIAPICLPEKNEDFLGKFG-WAAGWGALNPGSRL-RPKTLQAVDVPVIENRICER 770
            .||.::.|...|.|||||:.:.....|.. |.||||::..|..| .|:|||.:.||:|::.:|:.
Mouse   204 RLEHSIQFSERILPICLPDSSVRLPPKTDCWIAGWGSIQDGVPLPHPQTLQKLKVPIIDSELCKS 268

  Fly   771 WHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIY 835
            .:.:......|.:.||||||..|.:|:|.||||||||...:..|.|.|::|.|..||.|.:||:|
Mouse   269 LYWRGAGQEAITEGMLCAGYLEGERDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVY 333

  Fly   836 HSVSKTVDWVSYVV 849
            .|:.....||..:|
Mouse   334 TSLLAHRSWVQRIV 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 88/239 (37%)
Tryp_SPc 612..846 CDD:238113 88/239 (37%)
Prss22XP_006524968.4 Tryp_SPc 108..346 CDD:238113 89/241 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 166 1.000 Domainoid score I3858
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H23344
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.