DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and TMPRSS3

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_076927.1 Gene:TMPRSS3 / 64699 HGNCID:11877 Length:454 Species:Homo sapiens


Alignment Length:251 Identity:92/251 - (36%)
Similarity:133/251 - (52%) Gaps:15/251 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   598 SCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI-GSSRCGGSLISRRHVVTAGHCVARA-TPRQ 660
            :||   .::....|||||:.:....:||||.::. |...||||:|:...::||.|||... .|:.
Human   206 ACG---HRRGYSSRIVGGNMSLLSQWPWQASLQFQGYHLCGGSVITPLWIITAAHCVYDLYLPKS 267

  Fly   661 VHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLP 725
            ..:.:|  :::....|.|::.  |.:|..|.  |:.|:....||:::.|...:.|...|.|:|||
Human   268 WTIQVG--LVSLLDNPAPSHL--VEKIVYHS--KYKPKRLGNDIALMKLAGPLTFNEMIQPVCLP 326

  Fly   726 EKNEDFL-GKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAG 789
            ...|:|. ||..|.:||||...|:......|....||:|.|:||.......||   |...|||||
Human   327 NSEENFPDGKVCWTSGWGATEDGAGDASPVLNHAAVPLISNKICNHRDVYGGI---ISPSMLCAG 388

  Fly   790 YRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            |..||.|||||||||||:..:...|.|:|..|.|..||...:||:|..|:..:||:
Human   389 YLTGGVDSCQGDSGGPLVCQERRLWKLVGATSFGIGCAEVNKPGVYTRVTSFLDWI 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 89/236 (38%)
Tryp_SPc 612..846 CDD:238113 89/237 (38%)
TMPRSS3NP_076927.1 LDLa 74..107 CDD:238060
SRCR_2 112..210 CDD:292133 2/6 (33%)
Tryp_SPc 216..444 CDD:214473 89/236 (38%)
Tryp_SPc 217..447 CDD:238113 89/237 (38%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.