DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and PRSS22

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_071402.1 Gene:PRSS22 / 64063 HGNCID:14368 Length:317 Species:Homo sapiens


Alignment Length:301 Identity:104/301 - (34%)
Similarity:155/301 - (51%) Gaps:29/301 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 LRGCCHRTAKSANLGSSDFVGNAVDLTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFG 621
            |.|.|..|..|..|.:|..:.||..:         ||  .|:||    |.....|:|||:|:...
Human    10 LGGGCLGTFTSLLLLASTAILNAARI---------PV--PPACG----KPQQLNRVVGGEDSTDS 59

  Fly   622 SFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCVA--RATPRQVHVTLGDYVINSAVEPLP---AY 680
            .:||...| :.|:..|.|||::.|.|:||.||..  ...|....|.||.:.:.:     |   :.
Human    60 EWPWIVSIQKNGTHHCAGSLLTSRWVITAAHCFKDNLNKPYLFSVLLGAWQLGN-----PGSRSQ 119

  Fly   681 TFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDF-LGKFGWAAGWGAL 744
            ..||..::.||.:.:...|.. ||:::.|||::.|...:.|||||:.:... .....|.:|||::
Human   120 KVGVAWVEPHPVYSWKEGACA-DIALVRLERSIQFSERVLPICLPDASIHLPPNTHCWISGWGSI 183

  Fly   745 NPGSRL-RPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMH 808
            ..|..| .|:|||.:.||:|::.:|...:.:......|.::||||||..|.:|:|.||||||||.
Human   184 QDGVPLPHPQTLQKLKVPIIDSEVCSHLYWRGAGQGPITEDMLCAGYLEGERDACLGDSGGPLMC 248

  Fly   809 DKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            ..:|.|.|.|::|.|..||.|.:||:|.|:|....||..:|
Human   249 QVDGAWLLAGIISWGEGCAERNRPGVYISLSAHRSWVEKIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/241 (36%)
Tryp_SPc 612..846 CDD:238113 86/241 (36%)
PRSS22NP_071402.1 Tryp_SPc 50..288 CDD:238113 87/243 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H23344
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.