DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and si:dkeyp-93a5.2

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_021326346.1 Gene:si:dkeyp-93a5.2 / 571079 ZFINID:ZDB-GENE-131127-18 Length:130 Species:Danio rerio


Alignment Length:100 Identity:39/100 - (39%)
Similarity:56/100 - (56%) Gaps:5/100 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   746 PGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDK 810
            |.:...|:|||...|||:.|..|     .|.:...|...|:|||...||||:||||||||::..:
Zfish     7 PVNLSHPRTLQQTVVPVVINSDC-----NNLLGATITDNMMCAGLLQGGKDTCQGDSGGPMVSQQ 66

  Fly   811 NGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            ...|...|::|.|:.|....:||:|..||:..:|:
Zfish    67 CSVWVQSGIISKGHDCGQPYEPGVYTRVSQYQNWI 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 38/98 (39%)
Tryp_SPc 612..846 CDD:238113 39/99 (39%)
si:dkeyp-93a5.2XP_021326346.1 Tryp_SPc <9..103 CDD:238113 38/97 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.