DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and tmprss5

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_009289870.1 Gene:tmprss5 / 569688 ZFINID:ZDB-GENE-131121-184 Length:551 Species:Danio rerio


Alignment Length:315 Identity:104/315 - (33%)
Similarity:150/315 - (47%) Gaps:32/315 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   555 GLLRGCCHRTAKSANLGSSDFVGNAVDLTDLPQKNYGPV-NNEPSCGISLAKQTAQR-------- 610
            |.||...|:.....::| .::....|.:|...|.|...: ....||  |..|..|.:        
Zfish   246 GYLRLSKHKGVNLTDIG-PNYTDGFVQITSEYQSNLESLWRFRGSC--STGKVIALKCFECGTRA 307

  Fly   611 ---RIVGGDDAGFGSFPWQAYIRIGSSR-CGGSLISRRHVVTAGHCVARATPRQVH---VTLGDY 668
               ||:||.:|..|.:|||..:...:.. ||||:|:.:.:|||.|||......||.   |..|  
Zfish   308 KLPRIIGGVEAALGRWPWQVSLYYNNRHICGGSIITNQWIVTAAHCVHNYRLPQVPSWVVYAG-- 370

  Fly   669 VINSAVEPLPAYT-FGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFL 732
            :|.|.:..|..|. |.|.||..:..:......:  ||:::.|:..::|...|.|:|||:.:.|..
Zfish   371 IITSNLAKLAQYQGFAVERIIYNKNYNHRTHDN--DIALVKLKTPLNFSDTIRPVCLPQYDHDLP 433

  Fly   733 GKFG---WAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGG 794
            |  |   |.:|||...|...|.|:.|:...||:|..:.|......||   .|...||||||..|.
Zfish   434 G--GTQCWISGWGYTQPDDVLIPEVLKEAPVPLISTKKCNSSCMYNG---EITSRMLCAGYSEGK 493

  Fly   795 KDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            .|:|||||||||:......|.|:||||.|..||....||:|..|::.:.|:..::
Zfish   494 VDACQGDSGGPLVCQDENVWRLVGVVSWGTGCAEPNHPGVYSKVAEFLGWIYDII 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 89/241 (37%)
Tryp_SPc 612..846 CDD:238113 89/241 (37%)
tmprss5XP_009289870.1 SRCR_2 211..306 CDD:292133 14/62 (23%)
Tryp_SPc 311..544 CDD:214473 89/241 (37%)
Tryp_SPc 312..547 CDD:238113 89/243 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.