DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and TMPRSS4

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005271670.1 Gene:TMPRSS4 / 56649 HGNCID:11878 Length:494 Species:Homo sapiens


Alignment Length:383 Identity:101/383 - (26%)
Similarity:178/383 - (46%) Gaps:63/383 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   479 QNFGINELAAVQDVRNDYSLQDLDSASEATSSPQSASTFKEKVDITTDTECQHRGGTCEFFLGCW 543
            ::|......||:..::..:||.||||:....|    :.|....:...:|.|:..|.:.:      
Human    94 KSFPEGPAVAVRLSKDRSTLQVLDSATGNWFS----ACFDNFTEALAETACRQMGYSSK------ 148

  Fly   544 LSGGLIQGTCDGLLRGCCHRTAKSANLGSSDFVGNAVDLTDLPQK-----NYGPVNNEP------ 597
                               .|.::..:|....: :.|::|:..|:     :.||..:..      
Human   149 -------------------PTFRAVEIGPDQDL-DVVEITENSQELRMRNSSGPCLSGSLVSLHC 193

  Fly   598 -SCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRIGSSR-CGGSLISRRHVVTAGHCVARATPRQ 660
             :||.||...    |:||.::|...|:|||..|:..... ||||::....|:||.||..:     
Human   194 LACGKSLKTP----RVVGVEEASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRK----- 249

  Fly   661 VHVTLGDYVINSAVEPLPAY-TFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICL 724
             |..:.::.:.:..:.|.:: :..|.:|.:..:....|:.:  ||:::.|:..:.|...:.||||
Human   250 -HTDVFNWKVRAGSDKLGSFPSLAVAKIIIIEFNPMYPKDN--DIALMKLQFPLTFSGTVRPICL 311

  Fly   725 PEKNEDFLGKFG-WAAGWG-ALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLC 787
            |..:|:...... |..||| ....|.::....||| .|.||::..|.......|   .:.::|:|
Human   312 PFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQA-SVQVIDSTRCNADDAYQG---EVTEKMMC 372

  Fly   788 AGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            ||...||.|:||||||||||: ::.:|:::|:||.||.|.....||:|..||..::|:
Human   373 AGIPEGGVDTCQGDSGGPLMY-QSDQWHVVGIVSWGYGCGGPSTPGVYTKVSAYLNWI 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 75/237 (32%)
Tryp_SPc 612..846 CDD:238113 75/238 (32%)
TMPRSS4XP_005271670.1 LDLa 58..92 CDD:238060
SRCR_2 108..197 CDD:295335 18/118 (15%)
Tryp_SPc 204..429 CDD:214473 75/237 (32%)
Tryp_SPc 205..432 CDD:238113 75/238 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.