DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and tmprss13b

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005165399.1 Gene:tmprss13b / 564693 ZFINID:ZDB-GENE-090309-2 Length:475 Species:Danio rerio


Alignment Length:552 Identity:151/552 - (27%)
Similarity:214/552 - (38%) Gaps:129/552 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 VPPPTQYEQHETRHTRQLYFDSDTASSSFEFP-GLVSNSKPHGLKLYRDDVTKFGDINGPITALP 381
            :.||..|...:...|.|:        ..:..| .|.....||.::                |.:|
Zfish    20 ITPPPSYPSLQILSTTQV--------QPYYIPQPLPQIPAPHVVE----------------TTVP 60

  Fly   382 QQRPQRGFY------FGDTEFRTGPPAPVRQFGPQKNFQEYVGPSEYQGTRKSRYYPYKSSRSPR 440
            |||.|...|      :|.:   ||..|.|          ..|..:.|.|.   ||.|...:.|.|
Zfish    61 QQRTQAVSYRSKRCCYGGS---TGIAAVV----------VLVVIAVYLGV---RYGPSLWAFSER 109

  Fly   441 VVFPTNDNVGTTGPSGPAGSSGPSGNGVYFSDNIAFRDQNFGINELAAVQDVRNDYSLQDLDSAS 505
                  |....|.|.......|.             :|.:.|.:|...|: :.....||.|.|.|
Zfish   110 ------DAETDTCPGSAVNCDGR-------------KDCSLGSDESQCVR-IGTGNELQVLTSRS 154

  Fly   506 EATSSPQSASTFKEKVDITTDTECQHRGGTCEFFLGCWLSGGLIQGTCDGLLRGCCHRTAKSANL 570
             .:..|..|..:.:.:   .|..||..|....:      |.|:::....         ..:|.| 
Zfish   155 -GSFLPVCAQGWNKNI---ADQTCQQLGFRQSY------SYGVVKSNSP---------MFQSVN- 199

  Fly   571 GSSDFVGNAVDLTDLPQKNYGPVNNEPSC----GISL-----AKQTAQRRIVGGDDAGFGSFPWQ 626
              |..|.|.          .|.||...||    .:||     .:.....||:||..|..|.:|||
Zfish   200 --SQLVNNI----------QGRVNTSSSCPDQQSVSLQCCDCGRPPVSSRIIGGSVAAEGHWPWQ 252

  Fly   627 AYIRI-GSSRCGGSLISRRHVVTAGHCVARAT-----PRQVHVTLGDYVINSAVEPLPAYTFGVR 685
            |.:.. |...|||||::...::||.||..:.|     |....|.:|  .::....|.|.|   |:
Zfish   253 ASLHFQGKHSCGGSLVAPDFIITAAHCFPKETSGSQLPSNWKVYIG--FVSQLKLPSPYY---VK 312

  Fly   686 RIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDF-LGKFGWAAGWGALNPGSR 749
            .|.:|.  |:.|....:||::|.|.:..   ..:.|||||...:.| ..|..|..|:|.:..||.
Zfish   313 EIILHE--KYNPTTKNYDIALLKLNKPA---SDVEPICLPVIGQTFPPAKQCWTTGFGVIRQGSN 372

  Fly   750 LRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKN-GR 813
            ....:|..|.|.:|::.:|   :..|..|..|.:.|.|||...||||||||||||||....| |:
Zfish   373 SVSTSLMEVTVSLIDSSVC---NSPNVYNGEITENMQCAGDLRGGKDSCQGDSGGPLACKSNDGQ 434

  Fly   814 WYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            |:|.||.|.|..|....:||:|..|:|.:.|:
Zfish   435 WFLTGVTSWGEGCGQVNRPGVYSDVAKYLMWI 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 88/241 (37%)
Tryp_SPc 612..846 CDD:238113 88/242 (36%)
tmprss13bXP_005165399.1 SRCR_2 147..230 CDD:295335 25/114 (22%)
Tryp_SPc 237..466 CDD:214473 88/241 (37%)
Tryp_SPc 238..469 CDD:238113 88/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.