DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and zgc:100868

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_005164187.1 Gene:zgc:100868 / 554458 ZFINID:ZDB-GENE-040801-33 Length:654 Species:Danio rerio


Alignment Length:308 Identity:108/308 - (35%)
Similarity:141/308 - (45%) Gaps:63/308 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   556 LLRGCCHRTAKSANLGSSDFVGNAVDLTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGF 620
            ||.||      .|.|   |..|.|            |:|:               |||||.:|..
Zfish    17 LLTGC------DAQL---DVCGTA------------PLNS---------------RIVGGQNAPV 45

  Fly   621 GSFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCVARATPRQVHVTLG--------DYVINSAVEP 676
            |::|||..: |.||..||||||:.:.::||.||....:...:.|.||        .|.::|||. 
Zfish    46 GAWPWQVSLQRDGSHFCGGSLINNQWILTAAHCFPNPSTTGLLVYLGLQKLASFESYSMSSAVS- 109

  Fly   677 LPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFL-GKFGWAAG 740
                     .|..||  .:....:..||::|.|..||.|..:|.||||...:..|. |...|..|
Zfish   110 ---------NIIKHP--NYNSDTEDNDITLLQLASTVSFSNYIRPICLAASDSTFFNGTLVWITG 163

  Fly   741 WGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGG 804
            ||....|..| .|.|||.|.||::.||.|...:   |:: .|...|:|||...||||||||||||
Zfish   164 WGNTATGVSLPSPGTLQEVQVPIVGNRKCNCLY---GVS-KITDNMVCAGLLQGGKDSCQGDSGG 224

  Fly   805 PLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVVGLT 852
            |::..:...|...|:||.|..||....||:|..|||...|:...:..|
Zfish   225 PMVSKQGSVWIQSGIVSFGTGCAQPNFPGVYTRVSKYQSWIQQRITTT 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 95/244 (39%)
Tryp_SPc 612..846 CDD:238113 95/244 (39%)
zgc:100868XP_005164187.1 Tryp_SPc 36..265 CDD:214473 95/244 (39%)
Tryp_SPc 37..267 CDD:238113 95/245 (39%)
Tryp_SPc 331..509 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.