DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and prss8

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001016980.1 Gene:prss8 / 549734 XenbaseID:XB-GENE-5758112 Length:329 Species:Xenopus tropicalis


Alignment Length:258 Identity:86/258 - (33%)
Similarity:124/258 - (48%) Gaps:29/258 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   604 AKQTAQRRIVGGDDAGFGSFPWQAYIRI-GSSRCGGSLISRRHVVTAGHCVARATPRQ-----VH 662
            :::..|.|||||.||..|.|||||.:|. |:..||.:|||...:|||.||.    |..     ..
 Frog    22 SQEGVQSRIVGGHDASEGMFPWQASLRYDGNHVCGAALISANFIVTAAHCF----PSDHSLVGYS 82

  Fly   663 VTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEK 727
            |.||  |:...|....:....::::.::|  .::......|::|..|:....|...:.||.||..
 Frog    83 VYLG--VLQLGVPSSNSQLLKLKQVTIYP--SYSHDTSSGDLAVAALDSPATFSHVVQPISLPAA 143

  Fly   728 NEDF-LGKFGWAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNGINV--------VIY 782
            |..| :|......|||.:..|..| ..|.||..:|.:|..:.|...:     |:        .|.
 Frog   144 NVQFPIGMTCQVTGWGNIQQGVNLPGAKNLQVGNVKLIGRQTCNCLY-----NIKPSADSMGSIQ 203

  Fly   783 QEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            .:|:|||...|..|:|||||||||....||:.||..|||.|..|.::.:||:|..:|....|:
 Frog   204 PDMICAGSAAGSVDACQGDSGGPLTCTVNGKAYLAAVVSWGDECGAQNKPGVYILISAYASWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 84/249 (34%)
Tryp_SPc 612..846 CDD:238113 84/250 (34%)
prss8NP_001016980.1 Tryp_SPc 29..266 CDD:214473 84/249 (34%)
Tryp_SPc 30..269 CDD:238113 84/250 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.