DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and tmprss2

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001008623.1 Gene:tmprss2 / 494080 ZFINID:ZDB-GENE-041212-48 Length:486 Species:Danio rerio


Alignment Length:299 Identity:96/299 - (32%)
Similarity:138/299 - (46%) Gaps:18/299 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly   551 GTCDGLLRGCCHRTA-KSANLGSSDFVGNAVDLTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVG 614
            |..|.|.:..|.... |....|....:..::|.....|.:.........||     ::...||||
Zfish   195 GFNDNLAKQACAEIGYKDTYSGYQGILSPSLDFISACQSSTAVSLKCTDCG-----RSTGNRIVG 254

  Fly   615 GDD-AGFGSFPWQAYIRI-GSSRCGGSLISRRHVVTAGHCVARATPRQVHVTLGDYVINSAVEPL 677
            |.. ...|.:|||..:.. |...||||:|:...::||.|||.:.:..........|:..|  |..
Zfish   255 GTTVTSKGVWPWQVSLHYSGRHLCGGSIITPYWILTAAHCVHQFSNPGGWTVYAGYLTQS--EMA 317

  Fly   678 PAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFLGKFG-WAAGW 741
            .|....|.||.:|   .|.|..:..||:::.|...:....:|.|:|||.|...|..:.. :..||
Zfish   318 SASGNSVNRIVIH---DFNPNTNENDIALMRLNTALTISTNIRPVCLPNKGMSFTAQQDCYVTGW 379

  Fly   742 GALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPL 806
            |||..|.. ...|||...:.:|::.||......||:   |...|:|||...||.|||||||||||
Zfish   380 GALFSGGS-SSATLQEAKIQLIDSTICNSRPVYNGL---ITDTMICAGKLAGGVDSCQGDSGGPL 440

  Fly   807 MHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            :.:....|:|:|..|.|..||.|.:||:|.:|:..:||:
Zfish   441 VTNVRSLWWLLGDTSWGDGCAVRNKPGVYGNVTYFLDWI 479

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 85/236 (36%)
Tryp_SPc 612..846 CDD:238113 85/237 (36%)
tmprss2NP_001008623.1 LDLa 132..168 CDD:238060
SRCR_2 173..248 CDD:295335 10/57 (18%)
Tryp_SPc 251..479 CDD:214473 85/236 (36%)
Tryp_SPc 252..482 CDD:238113 85/237 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.