DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and CG11836

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001356925.1 Gene:CG11836 / 43007 FlyBaseID:FBgn0039272 Length:333 Species:Drosophila melanogaster


Alignment Length:281 Identity:96/281 - (34%)
Similarity:135/281 - (48%) Gaps:23/281 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   573 SDFVGNAVDLTDLPQ-----KNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI- 631
            |..|.||..|:|...     :|....|.:..||.|    ..:.|||||...|...:||.|.|.. 
  Fly    57 SSGVSNAFGLSDTEDEVEYTENSSLKNCDCDCGFS----NEEIRIVGGKPTGVNQYPWMARIVYD 117

  Fly   632 GSSRCGGSLISRRHVVTAGHCVARATPRQVHVTLGDY--VINSAVEPLPAYTFGVRRIDVHPYFK 694
            |...|||||:::.:|::|.|||.:....::.|..||:  .|.|..:.:......|.:     :..
  Fly   118 GKFHCGGSLLTKDYVLSAAHCVKKLRKSKIRVIFGDHDQEITSESQAIQRAVTAVIK-----HKS 177

  Fly   695 FTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFLGKFGWAAGWGALNPGSRLRPKTLQAVD 759
            |.|.....||::|.|.:.:.|...|.|||||..|.|..|:.|...|||..:.|..| |..:..|.
  Fly   178 FDPDTYNNDIALLRLRKPISFSKIIKPICLPRYNYDPAGRIGTVVGWGRTSEGGEL-PSIVNQVK 241

  Fly   760 VPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGY 824
            ||::....|   ..|...:..|...|||||  ....|||||||||||:.....:::::|:||.|.
  Fly   242 VPIMSITEC---RNQRYKSTRITSSMLCAG--RPSMDSCQGDSGGPLLLSNGVKYFIVGIVSWGV 301

  Fly   825 SCASRGQPGIYHSVSKTVDWV 845
            .|...|.||:|..|||.:.|:
  Fly   302 GCGREGYPGVYSRVSKFIPWI 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 84/236 (36%)
Tryp_SPc 612..846 CDD:238113 84/237 (35%)
CG11836NP_001356925.1 Tryp_SPc 97..325 CDD:238113 84/237 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.