DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and prss29

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001001228.1 Gene:prss29 / 407909 XenbaseID:XB-GENE-6453402 Length:330 Species:Xenopus tropicalis


Alignment Length:283 Identity:96/283 - (33%)
Similarity:143/283 - (50%) Gaps:29/283 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   580 VDLTDLPQKNY-GPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI-GSSRCGGSLIS 642
            |.|:.|..:.| |||              ..:|||||.|:..|.:|||..:.. |...|||||::
 Frog     7 VVLSILHHQAYGGPV--------------MSKRIVGGTDSEEGEWPWQISLEFEGGFLCGGSLLT 57

  Fly   643 RRHVVTAGHCVARATPRQVHVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVL 707
            ...|:||.||.......:....||.|.::....   |...||:.|.|||.:.:  :....||:::
 Frog    58 DSWVLTAAHCFDSMNVSKYTAYLGVYQLSDLDN---AVLRGVKNITVHPDYMY--EGSSGDIALI 117

  Fly   708 TLERTVHFMPHIAPICLPEKNEDF-LGKFGWAAGWGALNPGSRLR-PKTLQAVDVPVIENRICER 770
            .||..:.|.|.|.|:|||.::... :|...|..|||.:...:.|. |:|||..:|.:|....||.
 Frog   118 ELEEPIVFTPSIQPVCLPSQDVPLPMGTMCWVTGWGNIKENTPLEDPQTLQKAEVGLINRTSCEA 182

  Fly   771 WHRQN-----GINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRG 830
            .::.:     .|: :|..:|:||||:.|..|:|||||||||:.:.:..|...|:||.|..||...
 Frog   183 MYQSSLGYRPSIH-LIQDDMICAGYKQGKIDACQGDSGGPLVCNTSNTWLQFGIVSWGLGCAEPN 246

  Fly   831 QPGIYHSVSKTVDWVSYVVGLTM 853
            |||:|.:|...:.|:..:|...|
 Frog   247 QPGVYTNVQYYLTWIQELVPSVM 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/241 (36%)
Tryp_SPc 612..846 CDD:238113 86/241 (36%)
prss29NP_001001228.1 Tryp_SPc 26..263 CDD:238113 86/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.