DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and cfd

DIOPT Version :10

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_989320.1 Gene:cfd / 394945 XenbaseID:XB-GENE-973605 Length:265 Species:Xenopus tropicalis


Alignment Length:61 Identity:17/61 - (27%)
Similarity:24/61 - (39%) Gaps:20/61 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GIIPSAYERQHLSVESIRSLQRLVHYYRRLSRSSTSKELLFPPFIATDAFSSCFFPFTSRL 75
            |::.|.|.   |.|::.|:..|   .||.|....|:              .||...|:|||
 Frog    19 GLVLSLYA---LHVKAARARDR---DYRALCDVGTA--------------ISCSRVFSSRL 59

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 612..846 CDD:238113
cfdNP_989320.1 Tryp_SPc 27..251 CDD:238113 14/50 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.