DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and CG6462

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_648011.1 Gene:CG6462 / 38681 FlyBaseID:FBgn0035663 Length:319 Species:Drosophila melanogaster


Alignment Length:264 Identity:80/264 - (30%)
Similarity:124/264 - (46%) Gaps:31/264 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   606 QTA--QRRIVGGDDAGFGSFPWQAYIRIGSS-----RCGGSLISRRHVVTAGHCVARATPRQVHV 663
            |||  :.||.||:.|..|.||:|..:.|..|     :||||||:.:.|:||.||:..|...:::.
  Fly    69 QTAAVRTRIAGGELATRGMFPYQVGLVIQLSGADLVKCGGSLITLQFVLTAAHCLTDAIAAKIYT 133

  Fly   664 TLGDYV-INSAVEPLPAYTFGVRRIDVHPYFKFTPQADRF----DISVLTLERTVHFMPHIAPIC 723
            ....:. :..:||.|..         .|..|...|....|    |::::.|.|.|.....:.||.
  Fly   134 GATVFADVEDSVEELQV---------THRDFIIYPDYLGFGGYSDLALIRLPRKVRTSEQVQPIE 189

  Fly   724 LPEK--NEDFL-GKFGWAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEM 785
            |..:  :::|| ||....:|||.|...:..|.:.||.:|..||:...|..:...   .:|..:..
  Fly   190 LAGEFMHQNFLVGKVVTLSGWGYLGDSTDKRTRLLQYLDAEVIDQERCICYFLP---GLVSQRRH 251

  Fly   786 LCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYS--CASRGQPGIYHSVSKTVDWVSYV 848
            ||....| |:.:|.||||||:::......|||||.|.|.:  | ..|.|.:|..::..:.|:...
  Fly   252 LCTDGSN-GRGACNGDSGGPVVYHWRNVSYLIGVTSFGSAEGC-EVGGPTVYTRITAYLPWIRQQ 314

  Fly   849 VGLT 852
            ..:|
  Fly   315 TAMT 318

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 75/248 (30%)
Tryp_SPc 612..846 CDD:238113 75/248 (30%)
CG6462NP_648011.1 Tryp_SPc 76..311 CDD:214473 75/248 (30%)
Tryp_SPc 77..314 CDD:238113 75/250 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.