DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and CG13744

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_610439.1 Gene:CG13744 / 35906 FlyBaseID:FBgn0033363 Length:389 Species:Drosophila melanogaster


Alignment Length:373 Identity:140/373 - (37%)
Similarity:191/373 - (51%) Gaps:38/373 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   509 SSPQSASTFKEKVDITTDTECQHRGGT--CEFFLGCWLSGGLIQGTC--DGLLRGCC-------- 561
            |||..|:.....:.:  ..||.|:.|.  |:....|||.||.....|  :..|..||        
  Fly    18 SSPSQANILNTLLGV--PAECVHQSGVWPCKLSFSCWLQGGKHAKGCGSNKWLFSCCVAETQHPH 80

  Fly   562 ---HRTAKSANLGSSDFVGNAVDLTDLPQK-------NYGPVNNEPSCGI-SLAKQTAQRRIVGG 615
               |.:..|......|:....::|..||::       :...:|.:|.||: ..|:.|.|:||:||
  Fly    81 QQQHHSPSSPLANLVDYGKLKLNLNSLPKRIMLRRRDDNELLNPKPECGVPRTAQNTLQKRIIGG 145

  Fly   616 DDAGFGSFPWQAYIRIGSSRCGGSLISRRHVVTAGHCVARATPRQVHVTLGD---YVINSAVEPL 677
            ..|.|..:||||:|||...:|||.|||...|.||.||:.:|....:.|.||:   ..:....|||
  Fly   146 RPAQFAEYPWQAHIRIAEYQCGGVLISANMVATAAHCIQQAHLADITVYLGELDTQDLGHIHEPL 210

  Fly   678 PAYTFGVRRIDVHPYFKF-TPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFLGKFGWAAGW 741
            |....||.:..:||.|.| ..|.||:||::|.|.:...|..||.|||||:.....:|:.|..|||
  Fly   211 PVEKHGVLQKIIHPRFNFRMTQPDRYDIALLKLAQPTSFTEHILPICLPQYPIRLIGRKGLIAGW 275

  Fly   742 GAL-----NPGSRLRPKTLQAVDVPVIENRICERWHRQNGINVVIYQEMLCAGYRNGGKDSCQGD 801
            |..     :.|:.:    ||...||:|....|.|||....|||.|..||.|||:.:|..|:|.||
  Fly   276 GKTEAHMGHAGTNM----LQVASVPIITTLDCIRWHESKQINVEIKAEMFCAGHSDGHMDACLGD 336

  Fly   802 SGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            |||||:..:.||:.|:|:.|||:.|....||||||:|.|||.|:..||
  Fly   337 SGGPLVIKERGRFVLVGITSAGFGCGVDHQPGIYHNVQKTVRWIQEVV 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 106/242 (44%)
Tryp_SPc 612..846 CDD:238113 106/242 (44%)
CG13744NP_610439.1 Tryp_SPc 141..380 CDD:214473 106/242 (44%)
Tryp_SPc 142..383 CDD:238113 106/244 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D102995at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.