DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and PRSS48

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_011530223.1 Gene:PRSS48 / 345062 HGNCID:24635 Length:351 Species:Homo sapiens


Alignment Length:266 Identity:90/266 - (33%)
Similarity:131/266 - (49%) Gaps:21/266 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 CGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRIGSS-RCGGSLISRRHVVTAGHCVARA-TPRQV 661
            ||    :.....|:|||.||..|.:|||..:....: .|||||:|.|.::||.||:... |....
Human    42 CG----QPVYSSRVVGGQDAAAGRWPWQVSLHFDHNFICGGSLVSERLILTAAHCIQPTWTTFSY 102

  Fly   662 HVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPE 726
            .|.||...:..:.:.:..|   |.:|.:||.::.|..    |:::|.|...|.|...|.|||||.
Human   103 TVWLGSITVGDSRKRVKYY---VSKIVIHPKYQDTTA----DVALLKLSSQVTFTSAILPICLPS 160

  Fly   727 KNEDF-LGKFGWAAGWGALNPGS-RLRPKTLQAVDVPVIENRICERWHRQNGI-----NVVIYQE 784
            ..:.. :..|.|..|||.:...| |.....||..:||:|:.:.||:.:...||     ..||.::
Human   161 VTKQLAIPPFCWVTGWGKVKESSDRDYHSALQEAEVPIIDRQACEQLYNPIGIFLPALEPVIKED 225

  Fly   785 MLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            .:|||.....||||:|||||||....:|.|...||||.|..| .:..||:|.:|.....|::..:
Human   226 KICAGDTQNMKDSCKGDSGGPLSCHIDGVWIQTGVVSWGLEC-GKSLPGVYTNVIYYQKWINATI 289

  Fly   850 GLTMNI 855
            ....|:
Human   290 SRANNL 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/242 (36%)
Tryp_SPc 612..846 CDD:238113 86/242 (36%)
PRSS48XP_011530223.1 Tryp_SPc 50..285 CDD:214473 86/242 (36%)
Tryp_SPc 51..288 CDD:238113 86/244 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450300at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.