DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and prss60.3

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_002662541.2 Gene:prss60.3 / 335152 ZFINID:ZDB-GENE-030131-7092 Length:330 Species:Danio rerio


Alignment Length:262 Identity:90/262 - (34%)
Similarity:127/262 - (48%) Gaps:25/262 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   599 CGISLAKQTAQRRIVGGDDAGFGSFPWQAYI---RIGSSRCGGSLISRRHVVTAGHCVARATPRQ 660
            ||    :.....|||||.:|..||:|||..:   :.|...|||||||...|:||.||::..:   
Zfish    27 CG----QAPLNTRIVGGVNASPGSWPWQVSLHSPKYGGHFCGGSLISSEWVLTAAHCLSGVS--- 84

  Fly   661 VHVTLGDYVINSAVEPLPAY--TFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPIC 723
             ..||..|:.....:.:..|  :..|.:..||.  .:....:..||::|.|...|.|..:|.|:|
Zfish    85 -ETTLVVYLGRRTQQGINIYETSRNVAKSFVHS--SYNSNTNDNDIALLRLSSAVTFTNYIRPVC 146

  Fly   724 LPEKNEDF-LGKFGWAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNGI--NVVIYQE 784
            |..:|..: .|...|..|||.:..|..| .|..||...:||:.|..|      |.:  :..:...
Zfish   147 LAAQNSVYSAGTSSWITGWGDIQAGVNLPAPGILQETMIPVVANDRC------NALLGSGTVTNN 205

  Fly   785 MLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            |:|||...||||:||||||||::......|...|:.|.||.||....||:|..||:...|:|..:
Zfish   206 MICAGLTQGGKDTCQGDSGGPMVTRLCTVWVQAGITSWGYGCADPNSPGVYTRVSQYQSWISSKI 270

  Fly   850 GL 851
            .|
Zfish   271 SL 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 85/242 (35%)
Tryp_SPc 612..846 CDD:238113 85/242 (35%)
prss60.3XP_002662541.2 Tryp_SPc 36..269 CDD:238113 86/244 (35%)
Somatomedin_B 294..328 CDD:321959
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.