DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and CG6048

DIOPT Version :10

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_572282.1 Gene:CG6048 / 31528 FlyBaseID:FBgn0029827 Length:362 Species:Drosophila melanogaster


Alignment Length:136 Identity:29/136 - (21%)
Similarity:53/136 - (38%) Gaps:23/136 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  1001 TATHITPAVTVANGANQVKAESTNDSMNDSIASNDSMGTNSSGVSSTSSVAPKADIGAKKEQLLY 1065
            ||.|:|....:..|.:.:..|.|...             .|.|::...:|.|:....:|..||  
  Fly   138 TALHLTEVGCIEYGGSTIIGEDTTTK-------------KSGGITLPPTVLPEDCNCSKPPQL-- 187

  Fly  1066 LAQLLKFEVQFS-DFP--KGNHG-EYLTLVILSTEPPQLCHGSGASLQESHDE---AARGALEIL 1123
            :.|.: |:.|:: :||  |...| ...|..:.......:|..|..::...:|:   .....|::.
  Fly   188 ITQTI-FDKQYAFNFPQTKFTFGTPSFTYTVGCQHVSMICSSSQKAIMFFNDQYIINGNDILDVA 251

  Fly  1124 SKIGLH 1129
            :|..||
  Fly   252 AKYNLH 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 612..846 CDD:238113
CG6048NP_572282.1 Tryp_SPc 45..284 CDD:214473 29/136 (21%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.