DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Prss22

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001100454.1 Gene:Prss22 / 302971 RGDID:1310880 Length:307 Species:Rattus norvegicus


Alignment Length:274 Identity:95/274 - (34%)
Similarity:143/274 - (52%) Gaps:14/274 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   582 LTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPW-QAYIRIGSSRCGGSLISRRH 645
            ||.....:...:...|.||    |.....|:|||:|:....:|| .:.::.||..|.|||::.|.
  Rat    24 LTSTATVSAANIRGSPDCG----KPQQLNRVVGGEDSADAQWPWIVSILKNGSHHCAGSLLTNRW 84

  Fly   646 VVTAGHCVA--RATPRQVHVTLGDYVINSAVEPLP-AYTFGVRRIDVHPYFKFTPQADRFDISVL 707
            ||:|.||.:  ...|....|.||.:.:.:   |.| :...|:..:..||.:. ..:....||:::
  Rat    85 VVSAAHCFSSNMDKPSPYSVLLGAWKLGN---PGPRSQKVGIASVLPHPRYS-RKEGTHADIALV 145

  Fly   708 TLERTVHFMPHIAPICLPEKNEDFLGKFG-WAAGWGALNPGSRL-RPKTLQAVDVPVIENRICER 770
            .|||.:.|...|.|||||:.:........ |.||||::..|..| ||:|||.:.||:|:..:|:.
  Rat   146 RLERPIQFSERILPICLPDSSVHLPPNTNCWIAGWGSIQDGVPLPRPQTLQKLKVPIIDPELCKS 210

  Fly   771 WHRQNGINVVIYQEMLCAGYRNGGKDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIY 835
            .:.:......|.::||||||..|.:|:|.||||||||...:..|.|.|::|.|..||.|.:||:|
  Rat   211 LYWRGAGQEAITEDMLCAGYLEGKRDACLGDSGGPLMCQVDDHWLLTGIISWGEGCAERNRPGVY 275

  Fly   836 HSVSKTVDWVSYVV 849
            .|:.....||..:|
  Rat   276 TSLLAHRPWVQRIV 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 86/239 (36%)
Tryp_SPc 612..846 CDD:238113 86/239 (36%)
Prss22NP_001100454.1 Tryp_SPc 49..285 CDD:214473 86/239 (36%)
Tryp_SPc 50..288 CDD:238113 87/241 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H23344
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.010

Return to query results.
Submit another query.