DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Hpn

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:XP_038958880.1 Gene:Hpn / 29135 RGDID:61982 Length:559 Species:Rattus norvegicus


Alignment Length:375 Identity:109/375 - (29%)
Similarity:157/375 - (41%) Gaps:89/375 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   519 EKVDITTDTECQHRGGTCEFFLGCWLSGGLIQGTCDGLLRGCCH-----RTAKSANLGSSDF--- 575
            :|.:.|....|..|.......|||...         |.||...|     ||| .|| |:|.|   
  Rat   108 DKTEGTWRLLCSSRSNARVAGLGCEEM---------GFLRALAHSELDVRTA-GAN-GTSGFFCV 161

  Fly   576 ----------VGNAVDLTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIR 630
                      :.:.:.:.|.|:..:.....: .||   .::....|||||.|:..|.:|||..:|
  Rat   162 DEGGLPLAQRLLDVISVCDCPRGRFLTATCQ-DCG---RRKLPVDRIVGGQDSSLGRWPWQVSLR 222

  Fly   631 I-GSSRCGGSLISRRHVVTAGHC-----------------VARATPRQVHVTLGDYVINSAVEPL 677
            . |:..|||||:|...|:||.||                 |||.:|..|.:              
  Rat   223 YDGTHLCGGSLLSGDWVLTAAHCFPERNRVLSRWRVFAGAVARTSPHAVQL-------------- 273

  Fly   678 PAYTFGVRRIDVH----PYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFL-GKFGW 737
                 ||:.:..|    |:...|...:..||:::.|..::....:|.|:|||...:..: ||...
  Rat   274 -----GVQAVIYHGGYLPFRDPTIDENSNDIALVHLSSSLPLTEYIQPVCLPAAGQALVDGKVCT 333

  Fly   738 AAGWGALNPGSRLRPKTLQAVDVPVIENRIC---ERWHRQNGINVVIYQEMLCAGYRNGGKDSCQ 799
            ..|||......: :...||...||:|.|.:|   :.:..|      |..:|.||||..||.|:||
  Rat   334 VTGWGNTQFYGQ-QAVVLQEARVPIISNEVCNSPDFYGNQ------IKPKMFCAGYPEGGIDACQ 391

  Fly   800 GDSGGPLM-HDK---NGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            ||||||.: .|:   ..||.|.|:||.|..||...:||:|..|....:|:
  Rat   392 GDSGGPFVCEDRISGTSRWRLCGIVSWGTGCALARKPGVYTKVIDFREWI 441

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 85/263 (32%)
Tryp_SPc 612..846 CDD:238113 85/264 (32%)
HpnXP_038958880.1 Hepsin-SRCR 92..200 CDD:401275 23/106 (22%)
Tryp_SPc 204..441 CDD:238113 84/262 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.