DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and PRSS50

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_037402.1 Gene:PRSS50 / 29122 HGNCID:17910 Length:385 Species:Homo sapiens


Alignment Length:362 Identity:93/362 - (25%)
Similarity:147/362 - (40%) Gaps:67/362 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   527 TECQHRGGTCEFFL------GCWLSG---GLI--------------QGTCDGLLRGCCHRTAKSA 568
            |....|.|.....|      |||.:|   |.:              :.||.........:|..:.
Human    16 TSAPSRAGALLLLLLLLRSAGCWGAGEAPGALSTADPADQSVQCVPKATCPSSRPRLLWQTPTTQ 80

  Fly   569 NLGSSDFVGNAVDLTDLPQKNYGPVNNEPSCGISLAKQTAQRRIVGGDDAGFGSFPWQAYIRI-G 632
            .|.|:...      |..|... |.|:...|||.|..:....|    ..:|....:||...:|. |
Human    81 TLPSTTME------TQFPVSE-GKVDPYRSCGFSYEQDPTLR----DPEAVARRWPWMVSVRANG 134

  Fly   633 SSRCGGSLISRRHVVTAGHCVARATPRQV--HVTLGDYVINSAVEPLPAYTFGVRRIDVHPYFKF 695
            :..|.|::|:.:.|:|..||:..   |.|  .|.:|...|:...:  .|....|.::.:|..:: 
Human   135 THICAGTIIASQWVLTVAHCLIW---RDVIYSVRVGSPWIDQMTQ--TASDVPVLQVIMHSRYR- 193

  Fly   696 TPQADRF--------DISVLTLERTVHFMPHIAPICLPEKNEDFLGKFG---WAAGWGALNPGSR 749
               |.||        ||.:|.|::.:.:..::.|||||  ..|::.|..   ...||| |:....
Human   194 ---AQRFWSWVGQANDIGLLKLKQELKYSNYVRPICLP--GTDYVLKDHSRCTVTGWG-LSKADG 252

  Fly   750 LRP--KTLQAVDVPVIENRICER-WHRQNGINV---VIYQEMLCAGYRNGGKDSCQGDSGGPLMH 808
            :.|  :|:|..:|.::.|:.|:. :|....|..   :|..:|:||...:..| .|...:|.||:.
Human   253 MWPQFRTIQEKEVIILNNKECDNFYHNFTKIPTLVQIIKSQMMCAEDTHREK-FCYELTGEPLVC 316

  Fly   809 DKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            ...|.|||:|:||.|..|.....|.||..||....|:
Human   317 SMEGTWYLVGLVSWGAGCQKSEAPPIYLQVSSYQHWI 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 69/253 (27%)
Tryp_SPc 612..846 CDD:238113 70/254 (28%)
PRSS50NP_037402.1 Tryp_SPc 118..353 CDD:238113 69/247 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.