DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Prss27

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_891994.3 Gene:Prss27 / 287108 RGDID:1303256 Length:328 Species:Rattus norvegicus


Alignment Length:250 Identity:91/250 - (36%)
Similarity:139/250 - (55%) Gaps:18/250 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 RIVGGDDAGFGSFPWQAYI-RIGSSRCGGSLISRRHVVTAGHCVARATPRQVH-VTLGDYVINSA 673
            |:|||:||..|.:|||..| |.|:..||||||:...|:||.||.:..:...:: |.||...:.  
  Rat    37 RMVGGEDALEGEWPWQVSIQRNGAHFCGGSLIAPTWVLTAAHCFSNTSDISIYQVLLGALKLQ-- 99

  Fly   674 VEPLP-AYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFLGKFG- 736
             :|.| |....|:|:..||  ::...|...|::::.|:..|.|..:|.|:|||:.:..|  |.| 
  Rat   100 -QPGPHALYVPVKRVKSHP--EYQGMASSADVALVELQVPVTFTKYILPVCLPDPSVVF--KSGM 159

  Fly   737 --WAAGWGALNPGSRL-RPKTLQAVDVPVIENRICERWHRQNG---INV-VIYQEMLCAGYRNGG 794
              |..|||:.:...|| .|:.||.:.||:|:...|...:.::.   |.: .|..:|||||:..|.
  Rat   160 NCWVTGWGSPSEQDRLPNPRILQKLAVPLIDTPKCNLLYSKDAEADIQLKTIKDDMLCAGFAEGK 224

  Fly   795 KDSCQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWVSYVV 849
            ||:|:|||||||:...:..|...||:|.|..||.|.:||:|..|:....|:..::
  Rat   225 KDACKGDSGGPLVCLVDQSWVQAGVISWGEGCARRNRPGVYIRVASHYQWIHQII 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 90/244 (37%)
Tryp_SPc 612..846 CDD:238113 90/244 (37%)
Prss27NP_891994.3 Tryp_SPc 37..275 CDD:214473 90/244 (37%)
Tryp_SPc 39..278 CDD:238113 90/245 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24253
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.