DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8170 and Prss30

DIOPT Version :9

Sequence 1:NP_610441.2 Gene:CG8170 / 35908 FlyBaseID:FBgn0033365 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_955403.2 Gene:Prss30 / 287106 RGDID:735142 Length:304 Species:Rattus norvegicus


Alignment Length:243 Identity:91/243 - (37%)
Similarity:125/243 - (51%) Gaps:14/243 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   611 RIVGGDDAGFGSFPWQAYIRIGSSR--CGGSLISRRHVVTAGHCVARATPRQ-VHVTLGDYVINS 672
            :||||.||..|.:|||..:|.....  ||||||....|:||.||..|..... .||.:|...: |
  Rat    30 KIVGGQDAPEGRWPWQVSLRTEKEGHICGGSLIHEVWVLTAAHCFCRPLNSSFYHVKVGGLTL-S 93

  Fly   673 AVEPLPAYTFGVRRIDVHPYFKFTPQADRFDISVLTLERTVHFMPHIAPICLPEKNEDFL-GKFG 736
            ..|| .:....||.|.|:|.:.: ..|...||::|.|:..:. ....:|:|||:...... |...
  Rat    94 LTEP-HSTLVAVRNIFVYPTYLW-EDASSGDIALLRLDTPLQ-PSQFSPVCLPQAQAPLTPGTVC 155

  Fly   737 WAAGWGALNPGSRLRPKTLQAVDVPVIENRICERWHRQNGINV----VIYQEMLCAGYRNGGKDS 797
            |..||||.:  .|.....||.:.||::::..|||.:.....::    ||..:|||||:..|.|||
  Rat   156 WVTGWGATH--ERELASVLQELAVPLLDSEDCERMYHIGETSLSGKRVIQSDMLCAGFVEGQKDS 218

  Fly   798 CQGDSGGPLMHDKNGRWYLIGVVSAGYSCASRGQPGIYHSVSKTVDWV 845
            |||||||||:...|..|..:|:.|.|..||...:||:|..|...|||:
  Rat   219 CQGDSGGPLVCAINSSWIQVGITSWGIGCARPNKPGVYTRVPDYVDWI 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8170NP_610441.2 Tryp_SPc 611..845 CDD:214473 90/241 (37%)
Tryp_SPc 612..846 CDD:238113 91/242 (38%)
Prss30NP_955403.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D450300at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X21
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.